StarFunc result for job id Q709C8

User Input

>input (1400 residues)
MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGGNVALDNLQIKENALSELDVPFKVKAG
QIDKLTLKIPWKNLYGEAVVATLEGLYLLVVPGASIKYDAVKEEKSLQDVKQKELSRIEE
ALQKAAEKGTHSGEFIYGLENFVYKDIKPGRKRKKHKKHFKKPFKGLDRSKDKPKEAKKD
TFVEKLATQVIKNVQVKITDIHIKYEDDVTDPKRPLSFGVTLGELSLLTANEHWTPCILN
EADKIIYKLIRLDSLSAYWNVNCSMSYQRSREQILDQLKNEILTSGNIPPNYQYIFQPIS
ASAKLYMNPYAESELKTPKLDCNIEIQNIAIELTKPQYLSMIDLLESVDYMVRNAPYRKY
KPYLPLHTNGRRWWKYAIDSVLEVHIRRYTQMWSWSNIKKHRQLLKSYKIAYKNKLTQSK
VSEEIQKEIQDLEKTLDVFNIILARQQAQVEVIRSGQKLRKKSADTGEKRGGWFSGLWGK
KESKKKDEESLIPETIDDLMTPEEKDKLFTAIGYSESTHNLTLPKQYVAHIMTLKLVSTS
VTIRENKNIPEILKIQIIGLGTQVSQRPGAQALKVEAKLEHWYITGLRQQDIVPSLVASI
GDTTSSLLKIKFETNPEDSPADQTLIVQSQPVEVIYDAKTVNAVVEFFQSNKGLDLEQIT
SATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLVVPQTGFHHEKSDLLILDFGT
FQLNSKDQGLQKTTNSSLEEIMDKAYDKFDVEIKNVQLLFARAEETWKKCRFQHPSTMHI
LQPMDIHVELAKAMVEKDIRMARFKVSGGLPLMHVRISDQKMKDVLYLMNSIPLPQKSSA
QSPERQVSSIPIISGGTKGLLGTSLLLDTVESESDDEYFDAEDGEPQTCKSMKGSELKKA
AEVPNEELINLLLKFEIKEVILEFTKQQKEEDTILVFNVTQLGTEATMRTFDLTVVSYLK
KISLDYHEIEGSKRKPLHLISSSDKPGLDLLKVEYIKADKNGPSFQTAFGKTEQTVKVAF
SSLNLLLQTQALVASINYLTTIIPSDDQSISVAKEVQISTEKQQKNSTLPKAIVSSRDSD
IIDFRLFAKLNAFCVIVCNEKNNIAEIKIQGLDSSLSLQSRKQSLFARLENIIVTDVDPK
TVHKKAVSIMGNEVFRFNLDLYPDATEGDLYTDMSKVDGVLSLNVGCIQIVYLHKFLMSL
LNFLNNFQTAKESLSAATAQAAERAATSVKDLAQRSFRVSINIDLKAPVIVIPQSSISTN
AVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGIYHPDIQLLHP
INLEFLVNRNLAASWYHKVPVVEIKGHLDSMNVSLNQEDLNLLFRILTENLCEGTEDLDK
VKPRVQETGEIKEPLEISIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BY7	0.349	0.261	3.514E-49	2078	0.144	0.097	Q96BY7.pdb.gz	ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens OX=9606 GN=ATG2B PE=1 SV=5
2	AFDB:Q21480	0.349	0.239	1.359E-47	2290	0.124	0.076	Q21480.pdb.gz	ATG2_CAEEL Autophagy-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=atg-2 PE=1 SV=3
3	AFDB:Q2TAZ0	0.319	0.250	1.662E-45	1938	0.131	0.094	Q2TAZ0.pdb.gz	ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3
4	AFDB:Q9VZX7	0.356	0.280	1.841E-42	1906	0.131	0.096	Q9VZX7.pdb.gz	Q9VZX7_DROME Autophagy-related 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=2 SV=1
5	AFDB:F8S296	0.347	0.274	8.696E-41	1892	0.120	0.089	F8S296.pdb.gz	ATG2_ARATH Autophagy-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=ATG2 PE=2 SV=1
6	AFDB:Q9VZS7	0.325	0.220	2.758E-36	2300	0.090	0.055	Q9VZS7.pdb.gz	HOBIT_DROME Protein hobbit OS=Drosophila melanogaster OX=7227 GN=hob PE=3 SV=2
7	AFDB:P53855	0.336	0.302	1.441E-33	1592	0.112	0.099	P53855.pdb.gz	ATG2_YEAST Autophagy-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG2 PE=1 SV=1
8	AFDB:K7VLR4	0.347	0.212	2.050E-30	2605	0.093	0.050	K7VLR4.pdb.gz	APT1_MAIZE Protein ABERRANT POLLEN TRANSMISSION 1 OS=Zea mays OX=4577 GN=APT1 PE=2 SV=1
9	AFDB:Q6IMT0	0.343	0.211	2.267E-29	2587	0.094	0.051	Q6IMT0.pdb.gz	KIP_ARATH Protein KINKY POLLEN OS=Arabidopsis thaliana OX=3702 GN=KIP PE=2 SV=1
10	AFDB:A0JNW5	0.255	0.245	1.018E-28	1464	0.119	0.114	A0JNW5.pdb.gz	BLT3B_HUMAN Bridge-like lipid transfer protein family member 3B OS=Homo sapiens OX=9606 GN=BLTP3B PE=1 SV=2
11	PDB:6a9eA	0.086	0.287	5.272E-5	339	0.019	0.077	6a9eA.pdb.gz
12	PDB:5cslA	0.035	0.028	2.621E-2	2050	0.024	0.017	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
13	PDB:7dvq3	0.047	0.052	2.621E-2	1193	0.056	0.065	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:5cslB	0.039	0.030	4.112E-2	2072	0.023	0.015	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
15	PDB:6i7sG	0.043	0.060	5.553E-2	863	0.026	0.042	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
16	PDB:5cskA	0.047	0.038	5.839E-2	1996	0.053	0.037	5cskA.pdb.gz
17	PDB:5cskB	0.041	0.033	6.454E-2	2017	0.039	0.027	5cskB.pdb.gz
18	PDB:4bp8A	0.042	0.068	6.785E-2	712	0.024	0.046	4bp8A.pdb.gz
19	PDB:2gufA	0.061	0.128	1.942E-1	551	0.031	0.080	2gufA.pdb.gz	In Meso Structure of the Cobalamin Transporter, BtuB, at 1.95 A Resolution.
20	PDB:6ht9B	0.034	0.094	2.146E-1	316	0.017	0.076	6ht9B.pdb.gz	Structure of mammalian plasma fetuin-B and its mechanism of selective metallopeptidase inhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9RI63	0.0	2786	3754	0.971	0.362	A0A0D9RI63_CHLSB Vacuolar protein sorting 13 homolog C OS=Chlorocebus sabaeus OX=60711 GN=VPS13C PE=3 SV=1
2	A1Z713	0.0	615	3321	0.316	0.133	VPS13_DROME Intermembrane lipid transfer protein Vps13 OS=Drosophila melanogaster OX=7227 GN=Vps13 PE=1 SV=2
3	Q5H8C4	0.0	1126	3166	0.440	0.195	VP13A_MOUSE Intermembrane lipid transfer protein VPS13A OS=Mus musculus OX=10090 GN=Vps13a PE=1 SV=1
4	Q709C8	0.0	2859	3753	1.000	0.373	VP13C_HUMAN Intermembrane lipid transfer protein VPS13C OS=Homo sapiens OX=9606 GN=VPS13C PE=1 SV=1
5	Q8BX70	0.0	2453	3748	0.868	0.324	VP13C_MOUSE Intermembrane lipid transfer protein VPS13C OS=Mus musculus OX=10090 GN=Vps13c PE=1 SV=2
6	Q96RL7	0.0	1110	3174	0.446	0.197	VP13A_HUMAN Intermembrane lipid transfer protein VPS13A OS=Homo sapiens OX=9606 GN=VPS13A PE=1 SV=2
7	P87319	4.13e-80	295	3011	0.219	0.102	VP13A_SCHPO Intermembrane lipid transfer protein vps1301 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps1301 PE=3 SV=2
8	Q5THJ4	2.09e-51	202	4388	0.151	0.048	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
9	Q07878	6.01e-51	201	3144	0.205	0.091	VPS13_YEAST Intermembrane lipid transfer protein VPS13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS13 PE=1 SV=1
10	F4JNE2	2.61e-49	196	4219	0.139	0.046	F4JNE2_ARATH Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DL4605C PE=1 SV=1
11	Q55FG3	7.88e-43	174	3848	0.099	0.036	VP13C_DICDI Intermembrane lipid transfer protein tipC OS=Dictyostelium discoideum OX=44689 GN=tipC PE=3 SV=1
12	F4HWS2	2.13e-40	167	4146	0.132	0.045	F4HWS2_ARATH Calcium-dependent lipid-binding family protein OS=Arabidopsis thaliana OX=3702 GN=At1g48090 PE=1 SV=1
13	Q9VU08	6.86e-34	145	3919	0.074	0.027	VP13D_DROME Intermembrane lipid transfer protein Vps13D OS=Drosophila melanogaster OX=7227 GN=Vps13D PE=1 SV=3
14	F4KIH9	3.36e-22	107	3464	0.126	0.051	F4KIH9_ARATH Vacuolar protein sorting-associated protein, putative (DUF1162) OS=Arabidopsis thaliana OX=3702 GN=SHBY PE=1 SV=1
15	Q54KX3	1.16e-20	102	4246	0.055	0.018	VP13F_DICDI Intermembrane lipid transfer protein vps13F OS=Dictyostelium discoideum OX=44689 GN=vps13F PE=3 SV=1
16	Q57X24	1.62e-19	98.6	4810	0.115	0.033	Q57X24_TRYB2 Peroxin/Ferlin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.190 PE=3 SV=1
17	G0S3B8	4.55e-14	80.5	3225	0.071	0.031	VPS13_CHATD Intermembrane lipid transfer protein VPS13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=VPS13 PE=1 SV=1
18	Q9FT44	3.47e-11	70.9	3306	0.021	0.009	Q9FT44_ARATH VPS13-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g24740 PE=3 SV=1
19	Q80TY5	2.89e-10	67.8	3993	0.024	0.008	VP13B_MOUSE Intermembrane lipid transfer protein VPS13B OS=Mus musculus OX=10090 GN=Vps13b PE=1 SV=3
20	Q7Z7G8	3.04e-10	67.8	4022	0.024	0.008	VP13B_HUMAN Intermembrane lipid transfer protein VPS13B OS=Homo sapiens OX=9606 GN=VPS13B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12624 Chorein_N	1.3e-31	120.5	N-terminal region of Chorein or VPS13
2	PF16908 VPS13	4.1e-64	228.1	Vacuolar sorting-associated protein 13, N-terminal
3	PF16910 VPS13_mid_rpt	8.6e-82	285.5	Repeating coiled region of VPS13
4	PF10372 YojJ	6.1e+02	11.9	Bacterial membrane-spanning protein N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339374	0.805	Galectin-12
2	9606.ENSP00000299138	0.743	Vacuolar protein sorting-associated protein 35
3	9606.ENSP00000395835	0.733	Coiled-coil domain containing 129
4	9606.ENSP00000251119	0.698	Zinc finger FYVE domain-containing protein 26
5	9606.ENSP00000360108	0.684	Putative tyrosine-protein phosphatase auxilin
6	9606.ENSP00000266087	0.681	F-box only protein 7
7	9606.ENSP00000341364	0.662	Transmembrane protein 230
8	9606.ENSP00000327214	0.653	Cation-transporting ATPase 13A2
9	9606.ENSP00000409667	0.653	Synaptojanin-1
10	9606.ENSP00000272638	0.650	UBX domain-containing protein 4
11	9606.ENSP00000261866	0.642	Spatacsin
12	9606.ENSP00000355589	0.636	Signal-induced proliferation-associated 1-like protein 2
13	9606.ENSP00000299084	0.635	Sprouty-related, EVH1 domain-containing protein 1
14	9606.ENSP00000362381	0.632	Torsin-2A
15	9606.ENSP00000237822	0.619	Lipid droplet-associated hydrolase
16	9606.ENSP00000369755	0.619	C2 calcium-dependent domain-containing protein 4B
17	9606.ENSP00000347712	0.617	C2 calcium-dependent domain-containing protein 4A
18	9606.ENSP00000358466	0.583	Ras-related protein Rab-39B
19	9606.ENSP00000378812	0.574	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
20	9606.ENSP00000298910	0.566	Leucine-rich repeat serine/threonine-protein kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0120013	0.389	lipid transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009894	0.995	regulation of catabolic process
GO:0016241	0.976	regulation of macroautophagy
GO:0010821	0.958	regulation of mitochondrion organization
GO:1903146	0.921	regulation of autophagy of mitochondrion
GO:0048583	0.799	regulation of response to stimulus
GO:0080135	0.731	regulation of cellular response to stress
GO:0009987	0.628	cellular process
GO:0048519	0.604	negative regulation of biological process
GO:0048523	0.593	negative regulation of cellular process
GO:0048585	0.540	negative regulation of response to stimulus
GO:0051179	0.433	localization
GO:0006810	0.395	transport
GO:0071840	0.350	cellular component organization or biogenesis
GO:0016043	0.317	cellular component organization
GO:0048193	0.300	Golgi vesicle transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0098588	0.998	bounding membrane of organelle
GO:0012505	0.961	endomembrane system
GO:0031982	0.925	vesicle
GO:0097708	0.813	intracellular vesicle
GO:0019867	0.783	outer membrane
GO:0005739	0.783	mitochondrion
GO:0005741	0.765	mitochondrial outer membrane
GO:0043232	0.726	intracellular non-membrane-bounded organelle
GO:0031410	0.652	cytoplasmic vesicle
GO:0005829	0.557	cytosol
GO:0005768	0.548	endosome
GO:0005773	0.469	vacuole
GO:0005783	0.355	endoplasmic reticulum
GO:0012506	0.333	vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]