StarFunc result for job id Q709F0

User Input

>input (780 residues)
MKPGATGESDLAEVLPQHKFDSKSLEAYLNQHLSGFGAEREATLTIAQYRAGKSNPTFYL
QKGFQTYVLRKKPPGSLLPKAHQIDREFKVQKALFSIGFPVPKPILYCSDTSVIGTEFYV
MEHVQGRIFRDLTIPGLSPAERSAIYVATVETLAQLHSLNIQSLQLEGYGIGAGYCKRQV
STWTKQYQAAAHQDIPAMQQLSEWLMKNLPDNDNEENLIHGDFRLDNIVFHPKECRVIAV
LDWELSTIGHPLSDLAHFSLFYFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINS
ILPNWNFFLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPLAETGLQLSKRTFS
TVLPQIDTTGQLFVQTRKGQEVLIKVKHFMKQHILPAEKEVTEFYVQNENSVDKWGKPLV
IDKLKEMAKVEGLWNLFLPAVSGLSHVDYALIAEETGKCFFAPDVFNCQAPDTGNMEVLH
LYGSEEQKKQWLEPLLQGNITSCFCMTEPDVASSDATNIECSIQRDEDSYVINGKKWWSS
GAGNPKCKIAIVLGRTQNTSLSRHKQHSMILVPMNTPGVKIIRPLSVFGYTDNFHGGHFE
IHFNQVRVPATNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERALQIMCERATQRIAF
KKKLYAHEVVAHWIAESRIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSK
IVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3DMA2	0.938	0.939	0.000	779	0.801	0.802	B3DMA2.pdb.gz	ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus OX=10116 GN=Acad11 PE=1 SV=1
2	AFDB:Q709F0	1.000	1.000	0.000	780	1.000	1.000	Q709F0.pdb.gz	ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens OX=9606 GN=ACAD11 PE=1 SV=3
3	AFDB:Q8K370	0.506	0.371	3.428E-72	1069	0.458	0.334	Q8K370.pdb.gz	ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus OX=10090 GN=Acad10 PE=1 SV=1
4	AFDB:Q6JQN1	0.497	0.368	8.816E-72	1059	0.462	0.340	Q6JQN1.pdb.gz	ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens OX=9606 GN=ACAD10 PE=1 SV=1
5	AFDB:Q8RWZ3	0.505	0.479	1.397E-69	824	0.460	0.436	Q8RWZ3.pdb.gz	IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana OX=3702 GN=IBR3 PE=1 SV=1
6	AFDB:P96831	0.491	0.945	3.485E-38	403	0.260	0.504	P96831.pdb.gz	ACD2_MYCTU Probable acyl-CoA dehydrogenase FadE2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE2 PE=1 SV=4
7	AFDB:D3Z7X0	0.501	0.699	6.114E-35	555	0.247	0.348	D3Z7X0.pdb.gz	D3Z7X0_MOUSE Acyl-Coenzyme A dehydrogenase family, member 12 OS=Mus musculus OX=10090 GN=Acad12 PE=1 SV=1
8	AFDB:P96808	0.472	0.809	7.759E-28	447	0.187	0.327	P96808.pdb.gz	P96808_MYCTU Probable acyl-CoA dehydrogenase FadE1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE1 PE=1 SV=1
9	PDB:1jqiA	0.446	0.869	1.609E-22	384	0.136	0.276	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
10	AFDB:Q9VSA3	0.460	0.827	2.351E-22	419	0.131	0.243	Q9VSA3.pdb.gz	ACADM_DROME Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mcad PE=1 SV=1
11	AFDB:A0A0S2Z366	0.460	0.822	2.674E-22	421	0.128	0.238	A0A0S2Z366.pdb.gz	A0A0S2Z366_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=ACADM PE=2 SV=1
12	PDB:2a1tC	0.452	0.875	4.989E-21	388	0.124	0.250	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
13	PDB:6fahC	0.448	0.892	3.917E-20	379	0.123	0.253	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
14	PDB:1ivhA	0.431	0.832	8.126E-20	387	0.101	0.204	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
15	PDB:1rx0A	0.448	0.879	1.303E-19	384	0.119	0.242	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
16	PDB:6af6A	0.447	0.877	7.907E-19	383	0.119	0.243	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
17	PDB:7s7gA	0.417	0.558	2.156E-17	571	0.117	0.159	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
18	PDB:2r0mA	0.427	0.824	2.491E-16	390	0.100	0.200	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
19	PDB:2ix6A	0.431	0.780	1.647E-15	416	0.096	0.180	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
20	PDB:4xvxB	0.407	0.806	8.786E-15	373	0.085	0.177	4xvxB.pdb.gz	A covalent adduct of MbtN, an acyl-ACP dehydrogenase from Mycobacterium tuberculosis, reveals an unusual acyl-binding pocket.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DMA2	0.0	1342	779	0.803	0.804	ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus OX=10116 GN=Acad11 PE=1 SV=1
2	Q6JQN1	0.0	701	1059	0.473	0.348	ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens OX=9606 GN=ACAD10 PE=1 SV=1
3	Q709F0	0.0	1632	780	1.000	1.000	ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens OX=9606 GN=ACAD11 PE=1 SV=3
4	Q80XL6	0.0	1347	779	0.804	0.805	ACD11_MOUSE Acyl-CoA dehydrogenase family member 11 OS=Mus musculus OX=10090 GN=Acad11 PE=1 SV=2
5	Q8K370	0.0	699	1069	0.462	0.337	ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus OX=10090 GN=Acad10 PE=1 SV=1
6	Q8RWZ3	0.0	669	824	0.465	0.441	IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana OX=3702 GN=IBR3 PE=1 SV=1
7	P96831	3.38e-136	410	407	0.267	0.511	ACD2_MYCTU Probable acyl-CoA dehydrogenase FadE2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE2 PE=1 SV=4
8	D3Z7X0	4.27e-121	377	555	0.254	0.357	D3Z7X0_MOUSE Acyl-Coenzyme A dehydrogenase family, member 12 OS=Mus musculus OX=10090 GN=Acad12 PE=1 SV=1
9	P96808	3.38e-71	242	447	0.185	0.322	P96808_MYCTU Probable acyl-CoA dehydrogenase FadE1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE1 PE=1 SV=1
10	D3Z2B3	5.85e-64	220	373	0.144	0.300	D3Z2B3_MOUSE Acyl-Coenzyme A dehydrogenase family, member 12 OS=Mus musculus OX=10090 GN=Acad12 PE=1 SV=1
11	O69727	1.90e-42	160	351	0.144	0.319	O69727_MYCTU Possible acyl-CoA dehydrogenase FadE36 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE36 PE=1 SV=1
12	E5KSD5	1.60e-32	133	412	0.145	0.274	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
13	P16219	1.60e-32	133	412	0.145	0.274	ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
14	Q07417	1.56e-31	130	412	0.129	0.245	ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acads PE=1 SV=2
15	P15651	2.52e-31	129	412	0.129	0.245	ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acads PE=1 SV=2
16	G3KIM8	6.81e-31	127	394	0.149	0.294	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
17	P08503	7.63e-31	128	421	0.155	0.287	ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadm PE=1 SV=1
18	P45952	1.96e-30	127	421	0.153	0.283	ACADM_MOUSE Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadm PE=1 SV=1
19	Q9HZV8	1.68e-29	123	386	0.132	0.267	Q9HZV8_PSEAE Citronellyl-CoA dehydrogenase involved in catabolism of citronellol OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atuD PE=3 SV=1
20	B7Z9I1	1.83e-29	123	385	0.136	0.275	B7Z9I1_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	1.5e-29	114.6	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	3.1e-09	48.6	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	2.4e-15	67.8	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	9.4e-07	40.8	Acyl-CoA dehydrogenase, N-terminal domain
5	PF01636 APH	1.3e-38	144.8	Phosphotransferase enzyme family
6	PF01633 Choline_kinase	79	14.3	Choline/ethanolamine kinase
7	PF02958 EcKL	1.9	19.4	Ecdysteroid kinase-like family
8	PF03648 Glyco_hydro_67N	2.6e+02	13.3	Glycosyl hydrolase family 67 N-terminus
9	PF06293 Kdo	82	14.0	Lipopolysaccharide kinase (Kdo/WaaP) family
10	PF01163 RIO1	15	16.6	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264990

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348775	0.766	Peroxisomal acyl-coenzyme A oxidase 3
2	9606.ENSP00000382120	0.732	Apoptosis-inducing factor 3
3	9606.ENSP00000385927	0.728	Regulator of microtubule dynamics 1
4	9606.ENSP00000377494	0.726	Transgelin-3
5	9606.ENSP00000309836	0.708	Coiled-coil domain-containing protein 13
6	9606.ENSP00000196371	0.699	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
7	9606.ENSP00000369461	0.693	Enoyl-CoA delta isomerase 2, mitochondrial
8	9606.ENSP00000398064	0.693	HIG1 domain family member 1A, mitochondrial
9	9606.ENSP00000323678	0.692	Prostaglandin reductase 3
10	9606.ENSP00000364815	0.691	Valine--tRNA ligase
11	9606.ENSP00000304903	0.683	CD2 antigen cytoplasmic tail-binding protein 2
12	9606.ENSP00000407761	0.664	Acyl-coenzyme A oxidase-like protein
13	9606.ENSP00000360569	0.658	Non-specific lipid-transfer protein
14	9606.ENSP00000263035	0.651	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
15	9606.ENSP00000231887	0.645	Peroxisomal bifunctional enzyme
16	9606.ENSP00000424123	0.629	Elongation of very long chain fatty acids protein 7
17	9606.ENSP00000338766	0.625	Nephrocystin-3
18	9606.ENSP00000220764	0.620	2,4-dienoyl-CoA reductase, mitochondrial
19	9606.ENSP00000370023	0.612	Trifunctional enzyme subunit alpha, mitochondrial
20	9606.ENSP00000311505	0.609	IQ calmodulin-binding motif-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003995	1.000	acyl-CoA dehydrogenase activity
GO:0004466	0.754	long-chain-acyl-CoA dehydrogenase activity
GO:0043167	0.612	ion binding
GO:0036094	0.598	small molecule binding
GO:0043168	0.592	anion binding
GO:0097159	0.584	organic cyclic compound binding
GO:0070991	0.572	medium-chain-acyl-CoA dehydrogenase activity
GO:1901363	0.564	heterocyclic compound binding
GO:0000166	0.526	nucleotide binding
GO:0017099	0.341	very-long-chain-acyl-CoA dehydrogenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0009062	0.975	fatty acid catabolic process
GO:0006635	0.968	fatty acid beta-oxidation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.990	membrane
GO:0005634	0.963	nucleus
GO:0031090	0.909	organelle membrane
GO:0070013	0.889	intracellular organelle lumen
GO:0031975	0.563	envelope
GO:0031967	0.508	organelle envelope
GO:0005829	0.489	cytosol
GO:0005740	0.415	mitochondrial envelope
GO:0005743	0.413	mitochondrial inner membrane
GO:0012505	0.309	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	1.000	Acting on the CH-CH group of donors.
RHEA:17721	0.754	a long-chain 2,3-saturated fatty acyl-CoA + H(+) + oxidized [electron-transfer flavoprotein] = a long-chain (2E)-enoyl-CoA + reduced [electron-transfer flavoprotein]
EC:1.3.8.8	0.754	long-chain-acyl-CoA dehydrogenase.
RHEA:14477	0.572	a medium-chain 2,3-saturated fatty acyl-CoA + H(+) + oxidized [electron-transfer flavoprotein] = a medium-chain (2E)-enoyl-CoA + reduced [electron-transfer flavoprotein]
EC:1.3.8.7	0.572	medium-chain acyl-CoA dehydrogenase.
RHEA:19181	0.341	a very-long-chain 2,3-saturated fatty acyl-CoA + H(+) + oxidized [electron-transfer flavoprotein] = a very-long-chain (2E)-enoyl-CoA + reduced [electron-transfer flavoprotein]
EC:1.3.8.9	0.341	very-long-chain acyl-CoA dehydrogenase.

[back to server]