StarFunc result for job id Q70CQ2

User Input

>input (1400 residues)
MCENCADLVEVLNEISDVEGGDGLQLRKEHTLKIFTYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEPLNIDRECNEGSTERQK
SIEKKSNSTRICNLTEEESSKSSDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAYKHNTH
PTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFL
IAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTV
KEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETS
IAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKH
CSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQTLYLASMLIKALWNNALAAKA
QLSKQSSFASLLNTNIPIGNKKEEEELRRTAPSPWSPAASPQSSDNSDTHQSGGSDIEMD
EQLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQ
SAGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICLGDSQG
MSERNGTSSGTGKDLVFNTESLPSVDNRMRMLDACSHSEDPEHDISGEMNATHIAQGSQE
SCITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHDGHMVDDMLSADDVSCSSSQ
VSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPVVHKH
QFNSNAVTDINLDNVCKKGNTLLWDIVQDEDAVNLSEGLINEAEKLLCSLVCWFTDRQIR
MRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDN
LVYYIQTVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVE
DSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLA
RLATSAYDGCSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFIS
KCMESLMIASSSLEQESHSSLMVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHL
KALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQLQ
EFGQSNRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDMQMVFVSLGAPRRERK
GEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPSGKVAVDDSESLRC
EELHLHAENLSRRVWELLML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7yxxA	0.199	0.161	1.399E-5	1754	0.050	0.040	7yxxA.pdb.gz
2	PDB:7sukSP	0.130	0.109	6.581E-3	2234	0.096	0.060	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
3	PDB:7p3xB	0.115	0.205	1.871E-2	621	0.034	0.077	7p3xB.pdb.gz
4	PDB:7mqaLM	0.118	0.090	3.343E-2	2041	0.050	0.034	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:4a0cA	0.104	0.121	4.736E-2	1155	0.049	0.060	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
6	PDB:6kbnC	0.111	0.223	4.736E-2	504	0.036	0.099	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
7	PDB:3w3uA	0.122	0.154	5.320E-2	1030	0.028	0.038	3w3uA.pdb.gz
8	PDB:5lqwQ	0.086	0.126	5.748E-2	791	0.033	0.058	5lqwQ.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
9	PDB:7sx3E	0.122	0.111	5.748E-2	1611	0.055	0.048	7sx3E.pdb.gz	Structural architecture of the human NALCN channelosome.
10	PDB:7mopA	0.085	0.057	6.455E-2	2445	0.041	0.024	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
11	AFDB:E9QEX9	0.084	0.051	1.231E-1	2607	0.119	0.064	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
12	AFDB:F4IAT2	0.073	0.061	2.116E-1	1823	0.087	0.067	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
13	AFDB:A0A0G2K916	0.090	0.061	2.669E-1	2615	0.119	0.063	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
14	AFDB:Q5T1Z8	0.088	0.097	4.770E-1	1224	0.069	0.079	Q5T1Z8.pdb.gz	Q5T1Z8_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
15	AFDB:Q9W3K6	0.112	0.173	7.024E-1	801	0.063	0.110	Q9W3K6.pdb.gz	Q9W3K6_DROME LD35927p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2258 PE=1 SV=1
16	AFDB:Q961B0	0.144	0.178	7.301E-1	1067	0.069	0.091	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
17	AFDB:P25339	0.089	0.123	1.207	888	0.072	0.114	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
18	AFDB:Q5ADP3	0.073	0.086	1.583	1080	0.070	0.091	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
19	AFDB:Q8CIR4	0.072	0.056	2.618	2028	0.092	0.064	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
20	AFDB:Q9P789	0.091	0.113	3.177	1065	0.072	0.095	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q70CQ2	0.0	2919	3546	1.000	0.395	UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34 PE=1 SV=2
2	Q8IMW2	3.02e-148	503	3912	0.189	0.067	Q8IMW2_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
3	A0A0B4LIK5	3.08e-148	503	3921	0.189	0.067	A0A0B4LIK5_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
4	Q9VC56	3.19e-148	503	3912	0.189	0.067	PUF_DROME Ubiquitin carboxyl-terminal hydrolase puf OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
5	A0A0B4KHF3	3.20e-148	503	3921	0.189	0.067	A0A0B4KHF3_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
6	A0A0B4KI06	3.42e-148	503	3930	0.189	0.067	A0A0B4KI06_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
7	Q8IH89	4.40e-61	216	370	0.094	0.354	Q8IH89_DROME AT28817p OS=Drosophila melanogaster OX=7227 GN=puf PE=2 SV=1
8	F1Q6K1	2.27e-11	71.6	2621	0.044	0.024	F1Q6K1_DANRE Ubiquitin carboxyl-terminal hydrolase 24 isoform X1 OS=Danio rerio OX=7955 GN=usp24 PE=1 SV=2
9	Q9UPU5	6.25e-11	70.1	2620	0.069	0.037	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
10	P70398	8.02e-11	69.7	2559	0.046	0.025	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
11	Q93008	3.08e-10	67.8	2554	0.046	0.025	USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4
12	O00507	2.31e-09	65.1	2555	0.057	0.031	USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens OX=9606 GN=USP9Y PE=2 SV=2
13	Q695T8	7.18e-04	46.6	641	0.034	0.073	RHBL4_TOXGO Rhomboid-like protease 4 OS=Toxoplasma gondii OX=5811 GN=ROM4 PE=2 SV=1
14	P55824	0.002	45.1	2778	0.035	0.018	FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster OX=7227 GN=faf PE=1 SV=2
15	Q9LPZ4	2.5	33.9	204	0.019	0.132	PYM1_ARATH Partner of Y14 and mago OS=Arabidopsis thaliana OX=3702 GN=PYM PE=1 SV=1
16	G4SLH0	3.7	34.7	18562	0.029	0.002	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381577

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357297	0.951	E3 ubiquitin-protein ligase RNF146
2	9606.ENSP00000262320	0.939	Axin-1
3	9606.ENSP00000441543	0.936	Polyubiquitin-C
4	9606.ENSP00000311579	0.932	Tankyrase-1
5	9606.ENSP00000360689	0.930	Tankyrase-2
6	9606.ENSP00000272317	0.925	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000388107	0.917	Ubiquitin-60S ribosomal protein L40
8	9606.ENSP00000304697	0.916	Polyubiquitin-B
9	9606.ENSP00000302625	0.906	Axin-2
10	9606.ENSP00000316357	0.883	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
11	9606.ENSP00000376204	0.870	Histone-lysine N-methyltransferase ASH1L
12	9606.ENSP00000386759	0.845	Histone-lysine N-methyltransferase SETD2
13	9606.ENSP00000282516	0.835	Nipped-B-like protein
14	9606.ENSP00000393596	0.824	Baculoviral IAP repeat-containing protein 6
15	9606.ENSP00000438527	0.817	Zinc finger CCCH domain-containing protein 11A
16	9606.ENSP00000464893	0.777	RING finger protein unkempt homolog
17	9606.ENSP00000373696	0.751	E3 ubiquitin-protein ligase TRIP12
18	9606.ENSP00000429084	0.729	E3 ubiquitin-protein ligase UBR5
19	9606.ENSP00000307208	0.708	Nucleosome-remodeling factor subunit BPTF
20	9606.ENSP00000457703	0.708	Ubiquitin-like protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016579	0.990	protein deubiquitination
GO:0050789	0.977	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0009966	0.957	regulation of signal transduction
GO:0009987	0.946	cellular process
GO:0048518	0.912	positive regulation of biological process
GO:0048584	0.896	positive regulation of response to stimulus
GO:0048522	0.886	positive regulation of cellular process
GO:0030111	0.845	regulation of Wnt signaling pathway
GO:0198738	0.764	cell-cell signaling by wnt
GO:0060828	0.761	regulation of canonical Wnt signaling pathway
GO:0030177	0.742	positive regulation of Wnt signaling pathway
GO:0050896	0.735	response to stimulus
GO:0051716	0.710	cellular response to stimulus
GO:0090263	0.707	positive regulation of canonical Wnt signaling pathway
GO:1905114	0.681	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0016055	0.593	Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.986	cytosol
GO:0043226	0.535	organelle
GO:0043231	0.499	intracellular membrane-bounded organelle
GO:0005634	0.470	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]