StarFunc result for job id Q70CQ4

User Input

>input (1352 residues)
MSKVTAPGSGPPAAASGKEKRSFSKRLFRSGRAGGGGAGGPGASGPAAPSSPSSPSSARS
VGSFMSRVLKTLSTLSHLSSEGAAPDRGGLRSCFPPGPAAAPTPPPCPPPPASPAPPACA
AEPVPGVAGLRNHGNTCFMNATLQCLSNTELFAEYLALGQYRAGRPEPSPDPEQPAGRGA
QGQGEVTEQLAHLVRALWTLEYTPQHSRDFKTIVSKNALQYRGNSQHDAQEFLLWLLDRV
HEDLNHSVKQSGQPPLKPPSETDMMPEGPSFPVCSTFVQELFQAQYRSSLTCPHCQKQSN
TFDPFLCISLPIPLPHTRPLYVTVVYQGKCSHCMRIGVAVPLSGTVARLREAVSMETKIP
TDQIVLTEMYYDGFHRSFCDTDDLETVHESDCIFAFETPEIFRPEGILSQRGIHLNNNLN
HLKFGLDYHRLSSPTQTAAKQGKMDSPTSRAGSDKIVLLVCNRACTGQQGKRFGLPFVLH
LEKTIAWDLLQKEILEKMKYFLRPTVCIQVCPFSLRVVSVVGITYLLPQEEQPLCHPIVE
RALKSCGPGGTAHVKLVVEWDKETRDFLFVNTEDEYIPDAESVRLQRERHHQPQTCTLSQ
CFQLYTKEERLAPDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQEGDRRMKLQN
MVKFPLTGLDMTPHVVKRSQSSWSLPSHWSPWRRPYGLGRDPEDYIYDLYAVCNHHGTMQ
GGHYTAYCKNSVDGLWYCFDDSDVQQLSEDEVCTQTAYILFYQRRTAIPSWSANSSVAGS
TSSSLCEHWVSRLPGSKPASVTSAASSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRS
VQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIG
EAADDKVSISCFGSLRNLSSSYQEPSDSHSRREHKAVGRAPLAVMEGVFKDESDTRRLNS
SVVDTQSKHSAQGDRLPPLSGPFDNNNQIAYVDQSDSVDSSPVKEVKAPSHPGSLAKKPE
STTKRSPSSKGTSEPEKSLRKGRPALASQESSLSSTSPSSPLPVKVSLKPSRSRSKADSS
SRGSGRHSSPAPAQPKKESSPKSQDSVSSPSPQKQKSASALTYTASSTSAKKASGPATRS
PFPPGKSRTSDHSLSREGSRQSLGSDRASATSTSKPNSPRVSQARAGEGRGAGKHVRSSS
MASLRSPSTSIKSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLSKKAGGSSVK
SVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGV
PSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70CQ4	1.000	1.000	0.000	1352	1.000	1.000	Q70CQ4.pdb.gz	UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens OX=9606 GN=USP31 PE=2 SV=2
2	AFDB:Q70EL4	0.305	0.354	8.829E-87	1123	0.319	0.384	Q70EL4.pdb.gz	UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens OX=9606 GN=USP43 PE=1 SV=2
3	PDB:3mhsA	0.204	0.581	2.565E-19	455	0.075	0.224	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
4	AFDB:B2RQC2	0.210	0.214	3.590E-19	1324	0.155	0.159	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
5	AFDB:Q9H9J4	0.209	0.213	5.286E-19	1324	0.162	0.165	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
6	PDB:5cvnB	0.205	0.819	3.136E-17	321	0.070	0.293	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
7	PDB:5k16B	0.191	0.733	2.858E-16	328	0.072	0.299	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
8	PDB:4fjcE	0.189	0.555	1.342E-15	434	0.073	0.228	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
9	PDB:3ihpB	0.198	0.384	7.573E-14	681	0.067	0.134	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
10	PDB:7ay1D	0.203	0.750	2.852E-13	341	0.070	0.279	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
11	PDB:8a9kD	0.180	0.793	3.014E-13	285	0.066	0.312	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
12	PDB:4wa6D	0.185	0.577	5.534E-13	415	0.070	0.229	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
13	PDB:7w3ax	0.196	0.495	1.074E-12	494	0.060	0.164	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
14	PDB:7yxxA	0.190	0.148	1.670E-12	1754	0.070	0.054	7yxxA.pdb.gz
15	AFDB:P15975	0.169	0.210	3.495E-8	1069	0.123	0.155	P15975.pdb.gz	UBP53_MOUSE Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Mus musculus OX=10090 GN=Usp53 PE=1 SV=2
16	AFDB:Q70EK8	0.162	0.201	6.782E-8	1073	0.124	0.156	Q70EK8.pdb.gz	UBP53_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Homo sapiens OX=9606 GN=USP53 PE=1 SV=2
17	AFDB:Q70EL1	0.164	0.134	1.416E-6	1684	0.131	0.105	Q70EL1.pdb.gz	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
18	AFDB:E7F630	0.057	0.037	2.411E-4	2394	0.131	0.074	E7F630.pdb.gz
19	AFDB:Q1W9P9	0.150	0.118	1.014E-3	1765	0.123	0.094	Q1W9P9.pdb.gz	Q1W9P9_DROME Echinus splice form 3 OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=1
20	AFDB:F2Z3U3	0.053	0.056	4.263E-3	1266	0.137	0.146	F2Z3U3.pdb.gz	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q70CQ4	0.0	2761	1352	1.000	1.000	UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens OX=9606 GN=USP31 PE=2 SV=2
2	Q70EL4	0.0	687	1123	0.287	0.346	UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens OX=9606 GN=USP43 PE=1 SV=2
3	Q9USM5	1.01e-43	174	849	0.124	0.198	UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp1 PE=3 SV=1
4	Q9Y4E8	2.25e-41	168	981	0.071	0.098	UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3
5	E7EZD6	3.67e-41	167	1009	0.074	0.099	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
6	Q9R085	4.42e-41	167	952	0.070	0.100	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
7	Q8R5H1	6.20e-41	166	981	0.070	0.097	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
8	Q13107	6.90e-41	166	963	0.063	0.088	UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=3
9	P35123	8.93e-41	166	962	0.062	0.087	UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus OX=10090 GN=Usp4 PE=1 SV=3
10	F1RCS0	4.97e-40	164	1436	0.086	0.081	F1RCS0_DANRE Ubiquitin carboxyl-terminal hydrolase 19 isoform X3 OS=Danio rerio OX=7955 GN=usp19 PE=1 SV=1
11	Q8WT44	6.35e-39	160	1178	0.129	0.149	UBPH_CAEEL Ubiquitin carboxyl-terminal hydrolase cyk-3 OS=Caenorhabditis elegans OX=6239 GN=cyk-3 PE=1 SV=1
12	H7C189	6.43e-38	154	621	0.070	0.153	H7C189_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=1
13	O94966	3.04e-35	149	1318	0.072	0.074	UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2
14	Q6J1Y9	1.39e-34	147	1357	0.072	0.071	UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus OX=10116 GN=Usp19 PE=1 SV=1
15	Q3UJD6	2.38e-34	146	1360	0.079	0.079	UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus OX=10090 GN=Usp19 PE=1 SV=1
16	O22207	1.32e-33	143	924	0.050	0.073	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
17	P39538	4.67e-33	142	1254	0.055	0.060	UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP12 PE=1 SV=1
18	G5E9A6	3.38e-32	138	920	0.050	0.073	G5E9A6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=1
19	P51784	3.44e-32	138	963	0.055	0.078	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
20	Q5D006	7.95e-32	137	921	0.067	0.099	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	1.6e-61	219.9	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	1.3e-05	36.7	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219689

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414330	0.620	N-acetylaspartylglutamate synthase A
2	9606.ENSP00000386385	0.599	Peroxisomal membrane protein 4
3	9606.ENSP00000456480	0.567	Sorting nexin 29
4	9606.ENSP00000324127	0.532	PH and SEC7 domain-containing protein 3
5	9606.ENSP00000297109	0.526	Histone deacetylase complex subunit SAP30L
6	9606.ENSP00000445418	0.506	Protein FAM90A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005488	0.961	binding
GO:0005515	0.946	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0016579	0.975	protein deubiquitination
GO:0009987	0.783	cellular process
GO:0044237	0.467	cellular metabolic process
GO:0065007	0.427	biological regulation
GO:0050794	0.359	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.933	cytoplasm
GO:0070013	0.925	intracellular organelle lumen
GO:0016020	0.869	membrane
GO:0031981	0.686	nuclear lumen
GO:0005654	0.617	nucleoplasm
GO:0005829	0.409	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]