StarFunc result for job id Q70E73

User Input

>input (1250 residues)
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQK
LPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTK
PLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQ
PITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNL
MDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALF
KNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLL
RASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQ
YIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSS
SSIPESQSNHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSKARMESMNR
PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSA
APMFVKYSTITRLQNASQHSGALFKPPTPPVMQSQSVKPQILVPPNGVVPPPPPPPPPPT
PGSAMAQLKPAPCAPSLPQFSAPPPPLKIHQVQHITQVAPPTPPPPPPIPAPLPPQAPPK
PLVTIPAPTSTKTVAPVVTQAAPPTPTPPVPPAKKQPAFPASYIPPSPPTPPVPVPPPTL
PKQQSFCAKPPPSPLSPVPSVVKQIASQFPPPPTPPAMESQPLKPVPANVAPQSPPAVKA
KPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSPGKKT
SKTSSPGGKKPPPTPQRNSSIKSSSGAEHPEPKRPSVDSLVSKFTPPAESGSPSKETLPP
PAAPPKPGKLNLSGVNLPGVLQQGCVSAKAPVLSGRGKDSVVEFPSPPSDSDFPPPPPET
ELPLPPIEIPAVFSGNTSPKVAVVNPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISE
QPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDM
ALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F2Z3U3	0.504	0.498	0.000	1266	0.914	0.903	F2Z3U3.pdb.gz	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
2	AFDB:Q9VWB7	0.224	0.240	2.007E-36	1162	0.218	0.235	Q9VWB7.pdb.gz	Q9VWB7_DROME LD06925p OS=Drosophila melanogaster OX=7227 GN=pico PE=2 SV=1
3	AFDB:Q14CM0	0.085	0.081	1.012E-7	1322	0.107	0.101	Q14CM0.pdb.gz	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
4	AFDB:Q7KNQ9	0.068	0.055	7.055E-7	1557	0.122	0.098	Q7KNQ9.pdb.gz	Q7KNQ9_DROME Connector enhancer of KSR protein CNK OS=Drosophila melanogaster OX=7227 GN=cnk PE=1 SV=1
5	AFDB:D4A3K7	0.085	0.070	6.143E-6	1705	0.119	0.087	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
6	AFDB:O17905	0.098	0.108	1.070E-5	1091	0.109	0.125	O17905.pdb.gz	O17905_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=frm-3 PE=1 SV=2
7	PDB:4rm8A	0.082	0.191	5.967E-5	368	0.028	0.095	4rm8A.pdb.gz
8	AFDB:Q8CHI5	0.056	0.055	6.678E-5	1293	0.160	0.155	Q8CHI5.pdb.gz	PER1_RAT Period circadian protein homolog 1 OS=Rattus norvegicus OX=10116 GN=Per1 PE=1 SV=2
9	PDB:3ljuX	0.079	0.228	1.298E-4	373	0.026	0.086	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
10	PDB:6bbpA	0.068	0.158	1.533E-4	520	0.025	0.060	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
11	AFDB:A0A0A0MSA4	0.073	0.086	1.917E-4	1046	0.102	0.121	A0A0A0MSA4.pdb.gz	A0A0A0MSA4_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
12	AFDB:Q5BJ30	0.052	0.054	1.917E-4	1185	0.147	0.155	Q5BJ30.pdb.gz	Q5BJ30_MOUSE Per1 protein OS=Mus musculus OX=10090 GN=Per1 PE=2 SV=1
13	AFDB:Q5SYB0	0.087	0.073	2.393E-4	1578	0.118	0.093	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
14	PDB:6u3eA	0.076	0.228	3.153E-4	397	0.022	0.068	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:6hhgA	0.067	0.205	3.523E-4	386	0.014	0.047	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
16	PDB:7rx9A	0.074	0.193	3.724E-4	432	0.014	0.042	7rx9A.pdb.gz
17	PDB:4mk0A	0.068	0.128	8.099E-4	631	0.024	0.048	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:6s9wA	0.059	0.173	8.562E-4	411	0.014	0.044	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:4mt6A	0.076	0.225	1.335E-3	389	0.018	0.057	4mt6A.pdb.gz
20	PDB:7c3mA	0.073	0.143	2.080E-3	577	0.030	0.066	7c3mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9K0J5	0.0	2460	1302	1.000	0.960	C9K0J5_HUMAN Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=1
2	F2Z3U3	0.0	1800	1266	0.917	0.905	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
3	F2Z4B7	0.0	1170	645	0.449	0.870	F2Z4B7_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=1
4	G5E867	0.0	1100	679	0.449	0.826	G5E867_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=1
5	Q70E73	0.0	2484	1250	1.000	1.000	RAPH1_HUMAN Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3
6	Q7Z5R6	6.15e-132	421	666	0.162	0.303	AB1IP_HUMAN Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Homo sapiens OX=9606 GN=APBB1IP PE=1 SV=1
7	Q8R5A3	1.07e-127	410	670	0.154	0.287	AB1IP_MOUSE Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Mus musculus OX=10090 GN=Apbb1ip PE=1 SV=2
8	F2Z3X7	2.60e-122	378	213	0.146	0.854	F2Z3X7_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (Fragment) OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=1
9	S4R2K5	1.12e-104	331	216	0.138	0.796	S4R2K5_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (Fragment) OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
10	P34400	1.09e-65	240	779	0.098	0.158	MIG10_CAEEL Abnormal cell migration protein 10 OS=Caenorhabditis elegans OX=6239 GN=mig-10 PE=1 SV=3
11	Q8IQW0	5.98e-61	229	1034	0.087	0.105	Q8IQW0_DROME Pico, isoform B OS=Drosophila melanogaster OX=7227 GN=pico PE=4 SV=1
12	M9MSQ5	1.31e-60	229	1113	0.087	0.098	M9MSQ5_DROME Pico, isoform C OS=Drosophila melanogaster OX=7227 GN=pico PE=4 SV=1
13	Q9VWB7	1.67e-60	229	1162	0.087	0.094	Q9VWB7_DROME LD06925p OS=Drosophila melanogaster OX=7227 GN=pico PE=2 SV=1
14	Q5ICW4	8.29e-40	158	540	0.075	0.174	GRB14_BOVIN Growth factor receptor-bound protein 14 OS=Bos taurus OX=9913 GN=GRB14 PE=1 SV=1
15	Q14449	5.06e-39	155	540	0.074	0.172	GRB14_HUMAN Growth factor receptor-bound protein 14 OS=Homo sapiens OX=9606 GN=GRB14 PE=1 SV=2
16	O88900	4.62e-38	153	538	0.077	0.178	GRB14_RAT Growth factor receptor-bound protein 14 OS=Rattus norvegicus OX=10116 GN=Grb14 PE=1 SV=1
17	Q13322	6.90e-37	150	594	0.069	0.145	GRB10_HUMAN Growth factor receptor-bound protein 10 OS=Homo sapiens OX=9606 GN=GRB10 PE=1 SV=2
18	Q9JLM9	9.13e-35	143	538	0.076	0.177	GRB14_MOUSE Growth factor receptor-bound protein 14 OS=Mus musculus OX=10090 GN=Grb14 PE=1 SV=1
19	P0CE43	3.04e-34	142	599	0.070	0.145	GRB10_RAT Growth factor receptor-bound protein 10 OS=Rattus norvegicus OX=10116 GN=Grb10 PE=3 SV=1
20	Q14451	1.48e-33	139	532	0.063	0.148	GRB7_HUMAN Growth factor receptor-bound protein 7 OS=Homo sapiens OX=9606 GN=GRB7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	5.2e-07	41.5	PH domain
2	PF15413 PH_11	7.3e+02	12.1	Pleckstrin homology domain
3	PF00788 RA	1.8e-09	49.5	Ras association (RalGDS/AF-6) domain
4	PF02196 RBD	34	15.8	Raf-like Ras-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316543

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245932	0.983	Vasodilator-stimulated phosphoprotein
2	9606.ENSP00000355809	0.912	Protein enabled homolog
3	9606.ENSP00000365312	0.895	Abl interactor 1
4	9606.ENSP00000295851	0.859	Abl interactor 2
5	9606.ENSP00000298229	0.786	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
6	9606.ENSP00000316029	0.762	Talin-1
7	9606.ENSP00000340330	0.726	Histone acetyltransferase KAT5
8	9606.ENSP00000416739	0.726	ATP-dependent DNA helicase Q1
9	9606.ENSP00000459615	0.711	SLIT-ROBO Rho GTPase-activating protein 2
10	9606.ENSP00000264381	0.673	Cholinesterase
11	9606.ENSP00000417653	0.649	Drebrin-like protein
12	9606.ENSP00000453508	0.649	Talin-2
13	9606.ENSP00000403067	0.616	FERM domain-containing protein 5
14	9606.ENSP00000362413	0.613	Phosphoglycerate kinase 1
15	9606.ENSP00000358723	0.606	Ras-related protein Rap-1A
16	9606.ENSP00000269886	0.603	Endophilin-A2
17	9606.ENSP00000369981	0.600	Endophilin-A1
18	9606.ENSP00000292385	0.593	Drebrin
19	9606.ENSP00000320092	0.593	Endophilin-A3
20	9606.ENSP00000310406	0.578	Ras and Rab interactor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.366	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0016043	0.965	cellular component organization
GO:0032502	0.946	developmental process
GO:0048856	0.943	anatomical structure development
GO:0032501	0.938	multicellular organismal process
GO:0007275	0.897	multicellular organism development
GO:0048675	0.867	axon extension
GO:0050794	0.537	regulation of cellular process
GO:0050896	0.483	response to stimulus
GO:0051716	0.420	cellular response to stimulus
GO:0007165	0.309	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016020	0.996	membrane
GO:0005654	0.996	nucleoplasm
GO:0071944	0.995	cell periphery
GO:0005886	0.993	plasma membrane
GO:0016604	0.772	nuclear body
GO:0031252	0.457	cell leading edge
GO:0012505	0.387	endomembrane system
GO:0043232	0.321	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]