StarFunc result for job id Q70EK8

User Input

>input (1073 residues)
MAWVKFLRKPGGNLGKVYQPGSMLSLAPTKGLLNEPGQNSCFLNSAVQVLWQLDIFRRSL
RVLTGHVCQGDACIFCALKTIFAQFQHSREKALPSDNIRHALAESFKDEQRFQLGLMDDA
AECFENMLERIHFHIVPSRDADMCTSKSCITHQKFAMTLYEQCVCRSCGASSDPLPFTEF
VRYISTTALCNEVERMLERHERFKPEMFAELLQAANTTDDYRKCPSNCGQKIKIRRVLMN
CPEIVTIGLVWDSEHSDLTEAVVRNLATHLYLPGLFYRVTDENAKNSELNLVGMICYTSQ
HYCAFAFHTKSSKWVFFDDANVKEIGTRWKDVVSKCIRCHFQPLLLFYANPDGTAVSTED
ALRQVISWSHYKSVAENMGCEKPVIHKSDNLKENGFGDQAKQRENQKFPTDNISSSNRSH
SHTGVGKGPAKLSHIDQREKIKDISRECALKAIEQKNLLSSQRKDLEKGQRKDLGRHRDL
VDEDLSHFQSGSPPAPNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQIL
APGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNRGWKPMRETLNVDSIFSES
EKRQHSPRHKPNISNKPKSSKDPSFSNWPKENPKQKGLMTIYEDEMKQEIGSRSSLESNG
KGAEKNKGLVEGKVHGDNWQMQRTESGYESSDHISNGSTNLDSPVIDGNGTVMDISGVKE
TVCFSDQITTSNLNKERGDCTSLQSQHHLEGFRKELRNLEAGYKSHEFHPESHLQIKNHL
IKRSHVHEDNGKLFPSSSLQIPKDHNAREHIHQSDEQKLEKPNECKFSEWLNIENSERTG
LPFHVDNSASGKRVNSNEPSSLWSSHLRTVGLKPETAPLIQQQNIMDQCYFENSLSTECI
IRSASRSDGCQMPKLFCQNLPPPLPPKKYAITSVPQSEKSESTPDVKLTEVFKATSHLPK
HSLSTASEPSLEVSTHMNDERHKETFQVRECFGNTPNCPSSSSTNDFQANSGAIDAFCQP
ELDSISTCPNETVSLTTYFSVDSCMTDTYRLKYHQRPKLSFPESSGFCNNSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15975	0.504	0.505	0.000	1069	0.750	0.753	P15975.pdb.gz	UBP53_MOUSE Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Mus musculus OX=10090 GN=Usp53 PE=1 SV=2
2	AFDB:Q70EK8	1.000	1.000	0.000	1073	1.000	1.000	Q70EK8.pdb.gz	UBP53_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Homo sapiens OX=9606 GN=USP53 PE=1 SV=2
3	AFDB:Q70EL1	0.319	0.205	7.903E-58	1684	0.339	0.216	Q70EL1.pdb.gz	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
4	AFDB:A0A024R8V6	0.219	0.210	1.362E-14	1123	0.140	0.134	A0A024R8V6.pdb.gz
5	AFDB:E7F4C0	0.227	0.221	2.637E-14	1104	0.141	0.137	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
6	AFDB:B1AQJ2	0.224	0.219	3.288E-14	1098	0.152	0.148	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
7	PDB:5cvnB	0.202	0.616	9.829E-14	321	0.057	0.190	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
8	PDB:5k16B	0.212	0.621	1.368E-13	328	0.063	0.207	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
9	PDB:3mhsA	0.201	0.442	4.857E-13	455	0.059	0.138	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
10	PDB:8a9kD	0.193	0.657	9.941E-13	285	0.056	0.211	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
11	PDB:7yxxA	0.220	0.138	1.545E-12	1754	0.049	0.030	7yxxA.pdb.gz
12	PDB:5gjqx	0.212	0.580	3.530E-12	355	0.057	0.172	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
13	AFDB:Q9H9J4	0.227	0.186	6.514E-12	1324	0.142	0.115	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
14	PDB:7ay1D	0.224	0.633	8.066E-12	341	0.065	0.205	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
15	PDB:7w3ax	0.205	0.417	1.123E-11	494	0.048	0.105	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
16	AFDB:B2RQC2	0.239	0.198	1.409E-11	1324	0.139	0.113	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
17	PDB:4fjcE	0.193	0.436	5.548E-11	434	0.056	0.138	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
18	PDB:5mpc8	0.206	0.511	3.611E-10	395	0.051	0.139	5mpc8.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	AFDB:Q5W0Q7	0.155	0.153	6.817E-8	1092	0.136	0.134	Q5W0Q7.pdb.gz	USPL1_HUMAN SUMO-specific isopeptidase USPL1 OS=Homo sapiens OX=9606 GN=USPL1 PE=1 SV=1
20	AFDB:F6M2K2	0.045	0.046	8.611E-2	1070	0.102	0.102	F6M2K2.pdb.gz	F6M2K2_HUMAN Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15975	0.0	1600	1069	0.747	0.750	UBP53_MOUSE Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Mus musculus OX=10090 GN=Usp53 PE=1 SV=2
2	Q70EK8	0.0	2244	1073	1.000	1.000	UBP53_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Homo sapiens OX=9606 GN=USP53 PE=1 SV=2
3	Q70EL1	1.50e-160	519	1684	0.220	0.140	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
4	Q9H9I0	3.22e-128	389	188	0.174	0.995	Q9H9I0_HUMAN cDNA FLJ12737 fis, clone NT2RP2000337 OS=Homo sapiens OX=9606 PE=1 SV=1
5	Q1W9Q0	2.01e-99	348	1746	0.161	0.099	Q1W9Q0_DROME Echinus splice form 1 OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=1
6	O77283	2.57e-87	311	1712	0.142	0.089	O77283_DROME Echinus OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=2
7	Q1W9P9	4.63e-73	268	1765	0.124	0.075	Q1W9P9_DROME Echinus splice form 3 OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=1
8	Q7K7E6	2.18e-71	263	1761	0.123	0.075	Q7K7E6_DROME EG:EG0002.3 protein OS=Drosophila melanogaster OX=7227 GN=ec PE=4 SV=1
9	F4JCR3	1.14e-35	150	1607	0.103	0.068	F4JCR3_ARATH Ubiquitin carboxyl-terminal hydrolase-related protein OS=Arabidopsis thaliana OX=3702 GN=At3g47910 PE=1 SV=1
10	B1AQJ2	0.093	39.3	1098	0.039	0.038	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
11	Q9P275	0.094	39.3	1123	0.038	0.037	UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4
12	E9PEW0	0.16	38.5	548	0.038	0.075	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
13	E7F4C0	0.25	38.1	1104	0.041	0.040	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
14	Q7JW61	0.32	37.4	975	0.036	0.040	Q7JW61_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp20-33 PE=2 SV=1
15	Q9VRP5	0.37	37.4	1038	0.037	0.039	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
16	Q9P2H5	0.48	37.0	1018	0.026	0.028	UBP35_HUMAN Ubiquitin carboxyl-terminal hydrolase 35 OS=Homo sapiens OX=9606 GN=USP35 PE=1 SV=3
17	B2RQC2	0.65	36.6	1324	0.037	0.030	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
18	O74442	0.71	36.2	457	0.040	0.094	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
19	Q09879	1.1	35.8	1108	0.023	0.023	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
20	Q8BM15	1.1	35.4	349	0.018	0.054	CF015_MOUSE Uncharacterized protein C6orf15 homolog OS=Mus musculus OX=10090 GN=Stg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	5.3e-17	73.8	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409906

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000468956	0.730	Josephin-2
2	9606.ENSP00000064778	0.671	Protein FAM168A
3	9606.ENSP00000300574	0.664	Adapter molecule crk
4	9606.ENSP00000280701	0.613	3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
5	9606.ENSP00000434480	0.605	Alkaline ceramidase 3
6	9606.ENSP00000475489	0.603	M-phase phosphoprotein 9
7	9606.ENSP00000415579	0.585	Transcriptional repressor CTCFL
8	9606.ENSP00000301452	0.558	Alkaline ceramidase 1
9	9606.ENSP00000280551	0.553	Protein transport protein Sec24D
10	9606.ENSP00000378176	0.519	Phosphatidylcholine:ceramide cholinephosphotransferase 2
11	9606.ENSP00000364635	0.501	Protein-arginine deiminase type-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.487	hydrolase activity
GO:0140096	0.452	catalytic activity, acting on a protein
GO:0008233	0.435	peptidase activity
GO:0019783	0.422	ubiquitin-like protein peptidase activity
GO:0101005	0.413	deubiquitinase activity
GO:0008234	0.387	cysteine-type peptidase activity
GO:0004843	0.323	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.989	biological regulation
GO:0008219	0.970	cell death
GO:0071704	0.968	organic substance metabolic process
GO:0050896	0.967	response to stimulus
GO:0006807	0.958	nitrogen compound metabolic process
GO:1901564	0.929	organonitrogen compound metabolic process
GO:0044238	0.897	primary metabolic process
GO:0043170	0.860	macromolecule metabolic process
GO:0006508	0.836	proteolysis
GO:0050789	0.824	regulation of biological process
GO:0032501	0.778	multicellular organismal process
GO:0036211	0.773	protein modification process
GO:0050794	0.746	regulation of cellular process
GO:0070646	0.726	protein modification by small protein removal
GO:0003008	0.693	system process
GO:0009628	0.677	response to abiotic stimulus
GO:0065008	0.592	regulation of biological quality
GO:0016579	0.572	protein deubiquitination
GO:0050877	0.477	nervous system process
GO:0006915	0.476	apoptotic process
GO:0009605	0.465	response to external stimulus
GO:0007600	0.464	sensory perception
GO:0070997	0.337	neuron death
GO:0042391	0.332	regulation of membrane potential
GO:1904019	0.330	epithelial cell apoptotic process
GO:0048518	0.302	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005911	0.999	cell-cell junction
GO:0043231	0.856	intracellular membrane-bounded organelle
GO:0005634	0.835	nucleus
GO:0005737	0.790	cytoplasm
GO:0070160	0.781	tight junction
GO:0043296	0.778	apical junction complex
GO:0005923	0.770	bicellular tight junction
GO:0005829	0.595	cytosol
GO:0070013	0.538	intracellular organelle lumen
GO:0031981	0.528	nuclear lumen
GO:0005654	0.477	nucleoplasm
GO:0012505	0.401	endomembrane system
GO:0016020	0.366	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.487	Hydrolases.
EC:3.4.-.-	0.435	Acting on peptide bonds (peptidases).
EC:3.4.19.12	0.323	ubiquitinyl hydrolase 1.

[back to server]