StarFunc result for job id Q70EK9

User Input

>input (711 residues)
MAQVRETSLPSGSGVRWISGGGGGASPEEAVEKAGKMEEAAAGATKASSRREAEEMKLEP
LQEREPAPEENLTWSSSGGDEKVLPSIPLRCHSSSSPVCPRRKPRPRPQPRARSRSQPGL
SAPPPPPARPPPPPPPPPPPAPRPRAWRGSRRRSRPGSRPQTRRSCSGDLDGSGDPGGLG
DWLLEVEFGQGPTGCSHVESFKVGKNWQKNLRLIYQRFVWSGTPETRKRKAKSCICHVCS
THMNRLHSCLSCVFFGCFTEKHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDKDIEQI
AKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQSTCETKEQEPKLVKPKKKRRKKSVYTV
GLRGLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYS
GSRTPHIPYKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSGGQEANNPNCC
NCIIDQIFTGGLQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFDSQNPERADSTVSRD
DHIPGIPSLTDCLQWFTRPEHLGSSAKIKCNSCQSYQESTKQLTMKKLPIVACFHLKRFE
HVGKQRRKINTFISFPLELDMTPFLASTKESRMKEGQPPTDCVPNENKYSLFAVINHHGT
LESGHYTSFIRQQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHKQGLEKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70EK9	1.000	1.000	0.000	711	1.000	1.000	Q70EK9.pdb.gz	UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens OX=9606 GN=USP51 PE=1 SV=1
2	AFDB:A6NNY8	0.492	0.792	1.023E-63	438	0.442	0.717	A6NNY8.pdb.gz	UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens OX=9606 GN=USP27X PE=1 SV=3
3	PDB:3mhsA	0.505	0.766	2.471E-39	455	0.203	0.316	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
4	PDB:4fjcE	0.351	0.560	8.672E-34	434	0.191	0.313	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
5	PDB:4wa6D	0.452	0.743	6.950E-33	415	0.181	0.311	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
6	AFDB:X2JLM6	0.406	0.506	1.156E-29	565	0.195	0.246	X2JLM6.pdb.gz	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
7	AFDB:B1AQJ2	0.405	0.265	4.490E-27	1098	0.152	0.098	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
8	AFDB:A0A024R8V6	0.405	0.259	7.042E-27	1123	0.150	0.095	A0A024R8V6.pdb.gz
9	PDB:5cvnB	0.383	0.821	1.475E-26	321	0.132	0.293	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
10	PDB:5k16B	0.375	0.769	2.749E-25	328	0.132	0.287	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
11	PDB:3ihpB	0.377	0.393	5.711E-25	681	0.138	0.144	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
12	AFDB:Q9H9J4	0.398	0.217	7.937E-25	1324	0.135	0.073	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
13	PDB:5gjqx	0.367	0.707	2.330E-24	355	0.124	0.248	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
14	PDB:7yxxA	0.378	0.159	1.578E-23	1754	0.114	0.046	7yxxA.pdb.gz
15	PDB:7w3ax	0.382	0.536	2.474E-23	494	0.128	0.184	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
16	PDB:8a9kD	0.330	0.788	1.195E-22	285	0.124	0.309	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
17	AFDB:Q9W0L7	0.368	0.180	1.763E-21	1517	0.179	0.084	Q9W0L7.pdb.gz	Q9W0L7_DROME LD28815p OS=Drosophila melanogaster OX=7227 GN=Usp10 PE=1 SV=2
18	AFDB:A0A024QZ26	0.111	0.069	3.681E-4	1215	0.080	0.047	A0A024QZ26.pdb.gz
19	AFDB:Q9USU1	0.070	0.057	7.307E-1	987	0.080	0.058	Q9USU1.pdb.gz	EFC25_SCHPO Ras guanine nucleotide exchange factor efc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=efc25 PE=1 SV=1
20	AFDB:P17040	0.054	0.041	7.730E-1	1043	0.101	0.069	P17040.pdb.gz	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNY8	0.0	646	438	0.443	0.719	UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens OX=9606 GN=USP27X PE=1 SV=3
2	Q5DU02	0.0	749	525	0.518	0.701	UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus OX=10090 GN=Usp22 PE=2 SV=2
3	Q70EK9	0.0	1479	711	1.000	1.000	UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens OX=9606 GN=USP51 PE=1 SV=1
4	Q8CEG8	0.0	636	438	0.435	0.705	UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus OX=10090 GN=Usp27x PE=1 SV=2
5	Q9UPT9	0.0	754	525	0.518	0.701	UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens OX=9606 GN=USP22 PE=1 SV=2
6	Q9VVR1	5.80e-152	452	496	0.343	0.492	NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster OX=7227 GN=not PE=1 SV=4
7	Q9LEW0	2.36e-87	286	557	0.269	0.343	UBP22_ARATH Ubiquitin C-terminal hydrolase 22 OS=Arabidopsis thaliana OX=3702 GN=UBP22 PE=1 SV=1
8	Q09738	6.75e-60	210	449	0.212	0.336	UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp8 PE=3 SV=1
9	P50102	6.11e-59	208	471	0.204	0.308	UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP8 PE=1 SV=1
10	Q4JL29	3.04e-50	186	520	0.215	0.294	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1
11	Q6JHV3	8.14e-50	184	498	0.215	0.307	Q6JHV3_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
12	Q9Y6I4	9.58e-50	184	520	0.215	0.294	UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=2
13	A0A8I6A351	1.04e-49	184	506	0.214	0.300	A0A8I6A351_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
14	H0YMI4	4.51e-49	182	503	0.215	0.304	H0YMI4_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
15	A0A8I6A0C2	7.38e-49	181	482	0.211	0.311	A0A8I6A0C2_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
16	H0YLB7	5.62e-47	174	431	0.195	0.323	H0YLB7_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
17	D4A4F6	2.44e-46	173	476	0.194	0.290	D4A4F6_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=4
18	O57429	1.86e-42	159	357	0.160	0.319	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
19	A0A1D8PIP6	1.91e-42	165	613	0.201	0.233	A0A1D8PIP6_CANAL Ubiquitin carboxyl-terminal hydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBP8 PE=3 SV=1
20	H1UUC2	1.80e-40	154	367	0.156	0.302	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	1.7e-54	196.8	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	7.7e-13	60.3	Ubiquitin carboxyl-terminal hydrolase
3	PF02148 zf-UBP	7.4e-11	53.6	Zn-finger in ubiquitin-hydrolases and other protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000423333

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000397259	0.883	Ataxin-7-like protein 3
2	9606.ENSP00000352925	0.670	Transformation/transcription domain-associated protein
3	9606.ENSP00000307684	0.668	Transcriptional adapter 3
4	9606.ENSP00000252050	0.665	Cullin-9
5	9606.ENSP00000360515	0.663	Transcription initiation protein SPT3 homolog
6	9606.ENSP00000417510	0.662	SPT20 homolog, SAGA complex component
7	9606.ENSP00000288774	0.654	Peroxisome biogenesis factor 10
8	9606.ENSP00000263974	0.638	Transcription initiation factor TFIID subunit 12
9	9606.ENSP00000429986	0.632	Transcription and mRNA export factor ENY2
10	9606.ENSP00000272317	0.610	Ubiquitin-40S ribosomal protein S27a
11	9606.ENSP00000439585	0.609	Ataxin-7
12	9606.ENSP00000377862	0.596	Protocadherin Fat 4
13	9606.ENSP00000388107	0.586	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000332194	0.581	Histone H2A type 2-C
15	9606.ENSP00000003302	0.571	Ubiquitin carboxyl-terminal hydrolase 28
16	9606.ENSP00000401721	0.567	PAN2-PAN3 deadenylation complex catalytic subunit PAN2
17	9606.ENSP00000339389	0.562	OTU domain-containing protein 6A
18	9606.ENSP00000373772	0.531	E3 ubiquitin-protein ligase BRE1A
19	9606.ENSP00000299424	0.508	Transcription initiation factor TFIID subunit 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0042393	1.000	histone binding
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016579	0.996	protein deubiquitination
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0019219	0.969	regulation of nucleobase-containing compound metabolic process
GO:0016570	0.907	histone modification
GO:0016578	0.896	histone deubiquitination
GO:0048583	0.793	regulation of response to stimulus
GO:0080135	0.778	regulation of cellular response to stress
GO:0009987	0.720	cellular process
GO:2001020	0.684	regulation of response to DNA damage stimulus
GO:0006282	0.638	regulation of DNA repair
GO:2000779	0.591	regulation of double-strand break repair
GO:0010569	0.498	regulation of double-strand break repair via homologous recombination
GO:0044237	0.378	cellular metabolic process
GO:0010468	0.305	regulation of gene expression
GO:0051726	0.304	regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0032991	0.930	protein-containing complex
GO:0005694	0.886	chromosome
GO:0005737	0.857	cytoplasm
GO:0000785	0.849	chromatin
GO:0005829	0.670	cytosol
GO:1990234	0.410	transferase complex
GO:0031248	0.378	protein acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]