StarFunc result for job id Q70EL1

User Input

>input (1684 residues)
MSWKRNYFSGGRGSVQGMFAPRSSTSIAPSKGLSNEPGQNSCFLNSALQVLWHLDIFRRS
FRQLTTHKCMGDSCIFCALKGIFNQFQCSSEKVLPSDTLRSALAKTFQDEQRFQLGIMDD
AAECFENLLMRIHFHIADETKEDICTAQHCISHQKFAMTLFEQCVCTSCGATSDPLPFIQ
MVHYISTTSLCNQAICMLERREKPSPSMFGELLQNASTMGDLRNCPSNCGERIRIRRVLM
NAPQIITIGLVWDSDHSDLAEDVIHSLGTCLKLGDLFFRVTDDRAKQSELYLVGMICYYG
KHYSTFFFQTKIRKWMYFDDAHVKEIGPKWKDVVTKCIKGHYQPLLLLYADPQGTPVSTQ
DLPPQAEFQSYSRTCYDSEDSGREPSISSDTRTDSSTESYPYKHSHHESVVSHFSSDSQG
TVIYNVENDSMSQSSRDTGHLTDSECNQKHTSKKGSLIERKRSSGRVRRKGDEPQASGYH
SEGETLKEKQAPRNASKPSSSTNRLRDFKETVSNMIHNRPSLASQTNVGSHCRGRGGDQP
DKKPPRTLPLHSRDWEIESTSSESKSSSSSKYRPTWRPKRESLNIDSIFSKDKRKHCGYT
QLSPFSEDSAKEFIPDEPSKPPSYDIKFGGPSPQYKRWGPARPGSHLLEQHPRLIQRMES
GYESSERNSSSPVSLDAALPESSNVYRDPSAKRSAGLVPSWRHIPKSHSSSILEVDSTAS
MGGWTKSQPFSGEEISSKSELDELQEEVARRAQEQELRRKREKELEAAKGFNPHPSRFMD
LDELQNQGRSDGFERSLQEAESVFEESLHLEQKGDCAAALALCNEAISKLRLALHGASCS
THSRALVDKKLQISIRKARSLQDRMQQQQSPQQPSQPSACLPTQAGTLSQPTSEQPIPLQ
VLLSQEAQLESGMDTEFGASSFFHSPASCHESHSSLSPESSAPQHSSPSRSALKLLTSVE
VDNIEPSAFHRQGLPKAPGWTEKNSHHSWEPLDAPEGKLQGSRCDNSSCSKLPPQEGRGI
AQEQLFQEKKDPANPSPVMPGIATSERGDEHSLGCSPSNSSAQPSLPLYRTCHPIMPVAS
SFVLHCPDPVQKTNQCLQGQSLKTSLTLKVDRGSEETYRPEFPSTKGLVRSLAEQFQRMQ
GVSMRDSTGFKDRSLSGSLRKNSSPSDSKPPFSQGQEKGHWPWAKQQSSLEGGDRPLSWE
ESTEHSSLALNSGLPNGETSSGGQPRLAEPDIYQEKLSQVRDVRSKDLGSSTDLGTSLPL
DSWVNITRFCDSQLKHGAPRPGMKSSPHDSHTCVTYPERNHILLHPHWNQDTEQETSELE
SLYQASLQASQAGCSGWGQQDTAWHPLSQTGSADGMGRRLHSAHDPGLSKTSTAEMEHGL
HEARTVRTSQATPCRGLSRECGEDEQYSAENLRRISRSLSGTVVSEREEAPVSSHSFDSS
NVRKPLETGHRCSSSSSLPVIHDPSVFLLGPQLYLPQPQFLSPDVLMPTMAGEPNRLPGT
SRSVQQFLAMCDRGETSQGAKYTGRTLNYQSLPHRSRTDNSWAPWSETNQHIGTRFLTTP
GCNPQLTYTATLPERSKGLQVPHTQSWSDLFHSPSHPPIVHPVYPPSSSLHVPLRSAWNS
DPVPGSRTPGPRRVDMPPDDDWRQSSYASHSGHRRTVGEGFLFVLSDAPRREQIRARVLQ
HSQW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70EL1	1.000	1.000	0.000	1684	1.000	1.000	Q70EL1.pdb.gz	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
2	AFDB:Q70EK8	0.204	0.318	5.999E-53	1073	0.219	0.344	Q70EK8.pdb.gz	UBP53_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Homo sapiens OX=9606 GN=USP53 PE=1 SV=2
3	AFDB:P15975	0.206	0.321	3.553E-51	1069	0.208	0.328	P15975.pdb.gz	UBP53_MOUSE Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Mus musculus OX=10090 GN=Usp53 PE=1 SV=2
4	AFDB:Q1W9P9	0.161	0.154	3.754E-42	1765	0.214	0.205	Q1W9P9.pdb.gz	Q1W9P9_DROME Echinus splice form 3 OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=1
5	PDB:5cvnB	0.130	0.602	3.965E-14	321	0.040	0.209	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
6	PDB:5gjqx	0.151	0.634	4.307E-13	355	0.034	0.163	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
7	PDB:3mhsA	0.146	0.495	6.940E-13	455	0.040	0.147	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
8	PDB:5k16B	0.133	0.600	6.940E-13	328	0.040	0.207	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
9	PDB:7w3ax	0.145	0.449	5.201E-12	494	0.032	0.109	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
10	PDB:8a9kD	0.125	0.657	6.430E-12	285	0.034	0.204	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
11	PDB:7yxxA	0.139	0.134	1.583E-11	1754	0.034	0.033	7yxxA.pdb.gz
12	PDB:4fjcE	0.136	0.472	1.856E-11	434	0.037	0.145	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	AFDB:B2RQC2	0.146	0.182	2.639E-11	1324	0.134	0.170	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
14	PDB:5mpc8	0.145	0.553	5.358E-11	395	0.034	0.147	5mpc8.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
15	PDB:7ay1D	0.141	0.612	5.957E-11	341	0.036	0.179	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
16	AFDB:Q9H9J4	0.149	0.186	2.578E-10	1324	0.127	0.162	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
17	AFDB:A0A024R8V6	0.139	0.201	2.519E-9	1123	0.097	0.146	A0A024R8V6.pdb.gz
18	AFDB:Q70CQ4	0.132	0.162	3.696E-5	1352	0.103	0.128	Q70CQ4.pdb.gz	UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens OX=9606 GN=USP31 PE=2 SV=2
19	AFDB:P23201	0.044	0.048	1.912E-4	1466	0.092	0.106	P23201.pdb.gz	SPA2_YEAST Protein SPA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPA2 PE=1 SV=1
20	AFDB:Q5YL88	0.036	0.046	2.627E-4	1205	0.110	0.154	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q70EL1	0.0	3467	1684	1.000	1.000	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
2	Q1W9Q0	2.57e-106	378	1746	0.109	0.105	Q1W9Q0_DROME Echinus splice form 1 OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=1
3	O77283	9.66e-96	345	1712	0.096	0.095	O77283_DROME Echinus OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=2
4	Q1W9P9	9.35e-81	298	1765	0.084	0.080	Q1W9P9_DROME Echinus splice form 3 OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=1
5	Q7K7E6	4.00e-79	293	1761	0.084	0.080	Q7K7E6_DROME EG:EG0002.3 protein OS=Drosophila melanogaster OX=7227 GN=ec PE=4 SV=1
6	F4JCR3	7.25e-41	168	1607	0.068	0.072	F4JCR3_ARATH Ubiquitin carboxyl-terminal hydrolase-related protein OS=Arabidopsis thaliana OX=3702 GN=At3g47910 PE=1 SV=1
7	Q9WTV6	0.042	40.8	368	0.049	0.226	UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus OX=10090 GN=Usp18 PE=1 SV=2
8	G5E8G2	0.23	38.5	545	0.031	0.095	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
9	P48052	0.28	38.1	419	0.022	0.088	CBPA2_HUMAN Carboxypeptidase A2 OS=Homo sapiens OX=9606 GN=CPA2 PE=1 SV=3
10	Q70EK8	0.32	38.1	1073	0.029	0.046	UBP53_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Homo sapiens OX=9606 GN=USP53 PE=1 SV=2
11	Q7M764	0.35	37.7	540	0.030	0.094	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
12	G5E8I7	0.36	37.7	545	0.031	0.095	U17LC_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein C OS=Mus musculus OX=10090 GN=Usp17lc PE=1 SV=1
13	P15975	0.54	37.4	1069	0.026	0.040	UBP53_MOUSE Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Mus musculus OX=10090 GN=Usp53 PE=1 SV=2
14	Q8C2S0	0.58	37.4	711	0.009	0.021	UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus OX=10090 GN=Usp44 PE=1 SV=3
15	Q9H0E7	0.61	37.4	712	0.009	0.021	UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens OX=9606 GN=USP44 PE=1 SV=2
16	B6CS38	0.73	37.4	2868	0.020	0.012	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1
17	A0A0G2KQ62	0.77	37.0	2868	0.020	0.012	A0A0G2KQ62_DANRE Fibrillin 2b OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=2
18	P0C581	0.77	37.0	1310	0.011	0.014	PAN2_NEUCR PAN2-PAN3 deadenylation complex catalytic subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=par-1 PE=1 SV=2
19	Q9FPT1	0.80	37.0	1116	0.012	0.019	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
20	P19222	0.81	36.6	417	0.014	0.055	CBPA2_RAT Carboxypeptidase A2 OS=Rattus norvegicus OX=10116 GN=Cpa2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00758 EPO_TPO	5.6e+02	12.1	Erythropoietin/thrombopoietin
2	PF00443 UCH	2e-17	75.2	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	3.2	18.9	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270357	0.702	Aminopeptidase RNPEPL1
2	9606.ENSP00000425840	0.676	Ring finger protein 150
3	9606.ENSP00000343001	0.636	Ubiquitin conjugation factor E4 B
4	9606.ENSP00000296805	0.619	Ribosome-releasing factor 2, mitochondrial
5	9606.ENSP00000479526	0.601	Zinc finger protein DPF3
6	9606.ENSP00000468956	0.549	Josephin-2
7	9606.ENSP00000280614	0.542	Nocturnin
8	9606.ENSP00000312981	0.520	U4/U6.U5 tri-snRNP-associated protein 2
9	9606.ENSP00000431876	0.517	Ubiquitin specific peptidase 35
10	9606.ENSP00000423390	0.514	Ubiquitin carboxyl-terminal hydrolase 26
11	9606.ENSP00000328004	0.513	YY1 associated factor 2, isoform CRA_d
12	9606.ENSP00000283946	0.511	F-box only protein 36
13	9606.ENSP00000365678	0.511	OTU domain-containing protein 1
14	9606.ENSP00000216039	0.506	Josephin-1
15	9606.ENSP00000429896	0.506	Protein FAM178B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008233	0.476	peptidase activity
GO:0019783	0.474	ubiquitin-like protein peptidase activity
GO:0101005	0.455	deubiquitinase activity
GO:0004843	0.448	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.979	biological regulation
GO:0009987	0.977	cellular process
GO:0050794	0.927	regulation of cellular process
GO:0071704	0.569	organic substance metabolic process
GO:0043170	0.533	macromolecule metabolic process
GO:0044238	0.521	primary metabolic process
GO:0006807	0.513	nitrogen compound metabolic process
GO:0019538	0.490	protein metabolic process
GO:0016579	0.483	protein deubiquitination
GO:0032502	0.456	developmental process
GO:0048856	0.425	anatomical structure development
GO:0048518	0.343	positive regulation of biological process
GO:0007275	0.316	multicellular organism development
GO:0048522	0.308	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0043226	0.976	organelle
GO:0005737	0.973	cytoplasm
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005829	0.912	cytosol
GO:0030054	0.882	cell junction
GO:0005634	0.664	nucleus
GO:0070013	0.353	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.476	Acting on peptide bonds (peptidases).
EC:3.4.19.12	0.448	ubiquitinyl hydrolase 1.

[back to server]