StarFunc result for job id Q70EL3

User Input

>input (339 residues)
MTSQPSLPADDFDIYHVLAECTDYYDTLPVKEADGNQPHFQGVTGLWNLGNTCCVNAISQ
CLCSILPLVEYFLTGKYITALQKFLLPSDCSEVATAFAYLMTDMWLGDSDCVSPEIFWSA
LGNLYPAFTKKMQQDAQEFLICVLNELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETS
IITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWN
NEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHYPLTNLDLTPY
ICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70EL3	1.000	1.000	9.210E-74	339	1.000	1.000	Q70EL3.pdb.gz	UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens OX=9606 GN=USP50 PE=2 SV=1
2	AFDB:Q6P8X6	0.820	0.715	3.442E-49	390	0.767	0.667	Q6P8X6.pdb.gz	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
3	AFDB:D3ZN39	0.771	0.248	2.759E-30	1081	0.336	0.105	D3ZN39.pdb.gz	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
4	AFDB:P40818	0.767	0.245	1.887E-29	1118	0.351	0.106	P40818.pdb.gz	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
5	AFDB:O57429	0.784	0.747	3.183E-27	357	0.322	0.305	O57429.pdb.gz	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
6	AFDB:Q8MQX4	0.790	0.303	7.196E-27	896	0.295	0.112	Q8MQX4.pdb.gz	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
7	AFDB:O88623	0.768	0.429	1.725E-26	613	0.330	0.183	O88623.pdb.gz	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3
8	AFDB:E9QFQ5	0.762	0.642	6.031E-25	404	0.280	0.235	E9QFQ5.pdb.gz	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
9	AFDB:X2JG37	0.747	0.275	1.019E-24	950	0.274	0.098	X2JG37.pdb.gz	X2JG37_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
10	AFDB:Q8MSP3	0.763	0.272	1.624E-24	990	0.263	0.090	Q8MSP3.pdb.gz	Q8MSP3_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp20-33 PE=2 SV=1
11	PDB:5cvnB	0.692	0.729	2.746E-19	321	0.239	0.252	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
12	PDB:3mhsA	0.672	0.509	7.395E-19	455	0.212	0.158	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
13	PDB:5k16B	0.625	0.644	1.047E-16	328	0.236	0.244	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:7yxxA	0.640	0.134	3.560E-16	1754	0.215	0.042	7yxxA.pdb.gz
15	PDB:4fjcE	0.583	0.465	3.259E-15	434	0.204	0.159	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
16	PDB:3ihpB	0.592	0.305	6.558E-15	681	0.174	0.087	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
17	PDB:7ay1D	0.686	0.682	1.174E-14	341	0.224	0.223	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:8a9kD	0.580	0.683	1.320E-14	285	0.204	0.242	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
19	PDB:5gjqx	0.633	0.606	4.353E-13	355	0.204	0.194	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:4wa6D	0.572	0.473	6.176E-13	415	0.206	0.169	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P8X6	0.0	525	390	0.767	0.667	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
2	Q70EL3	0.0	709	339	1.000	1.000	UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens OX=9606 GN=USP50 PE=2 SV=1
3	D3ZN39	3.21e-64	221	1081	0.348	0.109	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
4	Q80U87	4.89e-64	221	1080	0.345	0.108	UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus OX=10090 GN=Usp8 PE=1 SV=2
5	P40818	2.38e-63	219	1118	0.348	0.106	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
6	A0A8I6A1E0	7.53e-52	186	1026	0.295	0.097	A0A8I6A1E0_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=1
7	O57429	1.52e-48	168	357	0.327	0.311	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
8	H1UUC2	6.85e-47	164	367	0.298	0.275	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
9	Q9VDD8	5.18e-45	166	896	0.298	0.113	Q9VDD8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=1 SV=2
10	Q8MQX4	3.82e-44	164	896	0.295	0.112	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
11	Q5U349	2.88e-42	157	618	0.324	0.178	UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1
12	O88623	3.38e-42	156	619	0.324	0.178	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3
13	O75604	4.17e-41	153	605	0.333	0.187	UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2
14	Q9UK80	6.45e-40	149	565	0.298	0.179	UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens OX=9606 GN=USP21 PE=1 SV=1
15	B2GUX4	8.05e-40	149	565	0.295	0.177	UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus OX=10116 GN=Usp21 PE=2 SV=1
16	Q9QZL6	1.16e-39	149	566	0.298	0.178	UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus OX=10090 GN=Usp21 PE=1 SV=1
17	E9QFQ5	1.06e-37	140	404	0.298	0.250	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
18	X2JLM6	3.38e-33	131	565	0.268	0.161	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
19	Q8IQ27	2.09e-32	130	938	0.268	0.097	UBP2_DROME Ubiquitin carboxyl-terminal hydrolase Usp2 OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=1 SV=1
20	X2JG37	2.14e-32	130	950	0.268	0.096	X2JG37_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	2.1e-49	180.1	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	5.7e-07	41.1	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434676

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335153	0.687	Heat shock protein HSP 90-alpha
2	9606.ENSP00000263966	0.663	Ubiquitin carboxyl-terminal hydrolase 13
3	9606.ENSP00000309031	0.662	Deubiquitinating protein VCIP135
4	9606.ENSP00000433146	0.639	Ubiquitin carboxyl-terminal hydrolase 47
5	9606.ENSP00000326813	0.606	Ubiquitin thioesterase OTU1
6	9606.ENSP00000312299	0.603	Protein FRG2-like-2
7	9606.ENSP00000432459	0.580	Transmembrane protein 262
8	9606.ENSP00000468956	0.578	Josephin-2
9	9606.ENSP00000343535	0.569	Ubiquitin carboxyl-terminal hydrolase 7
10	9606.ENSP00000285420	0.567	[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 . May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation . May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation . May also play a role in proteasome assembly and function
11	9606.ENSP00000339389	0.567	OTU domain-containing protein 6A
12	9606.ENSP00000383044	0.558	Ubiquitin carboxyl-terminal hydrolase 25
13	9606.ENSP00000257548	0.540	Ubiquitin carboxyl-terminal hydrolase 30
14	9606.ENSP00000352676	0.537	Ubiquitin thioesterase ZRANB1
15	9606.ENSP00000216039	0.535	Josephin-1
16	9606.ENSP00000401721	0.527	PAN2-PAN3 deadenylation complex catalytic subunit PAN2
17	9606.ENSP00000003302	0.526	Ubiquitin carboxyl-terminal hydrolase 28
18	9606.ENSP00000337122	0.517	Zinc finger protein 354A
19	9606.ENSP00000369996	0.504	Ataxin-3-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0004843	0.998	cysteine-type deubiquitinase activity
GO:0005515	0.989	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0016579	0.988	protein deubiquitination
GO:0050794	0.985	regulation of cellular process
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0048518	0.943	positive regulation of biological process
GO:0009987	0.939	cellular process
GO:0051171	0.938	regulation of nitrogen compound metabolic process
GO:0080090	0.936	regulation of primary metabolic process
GO:0010468	0.875	regulation of gene expression
GO:0030162	0.839	regulation of proteolysis
GO:0044087	0.766	regulation of cellular component biogenesis
GO:0009893	0.726	positive regulation of metabolic process
GO:0051173	0.713	positive regulation of nitrogen compound metabolic process
GO:0010604	0.706	positive regulation of macromolecule metabolic process
GO:0065009	0.624	regulation of molecular function
GO:0051247	0.622	positive regulation of protein metabolic process
GO:0043085	0.597	positive regulation of catalytic activity
GO:0048522	0.575	positive regulation of cellular process
GO:0045862	0.560	positive regulation of proteolysis
GO:0071840	0.524	cellular component organization or biogenesis
GO:0052547	0.523	regulation of peptidase activity
GO:0010952	0.502	positive regulation of peptidase activity
GO:0001817	0.499	regulation of cytokine production
GO:2000116	0.478	regulation of cysteine-type endopeptidase activity
GO:0016043	0.474	cellular component organization
GO:2001056	0.402	positive regulation of cysteine-type endopeptidase activity
GO:0048519	0.339	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.978	cytoplasm
GO:0070013	0.947	intracellular organelle lumen
GO:0005634	0.937	nucleus
GO:0031981	0.705	nuclear lumen
GO:0005829	0.495	cytosol
GO:0005654	0.491	nucleoplasm
GO:0012505	0.402	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.998	ubiquitinyl hydrolase 1.

[back to server]