StarFunc result for job id Q70EL4

User Input

>input (1123 residues)
MDLGPGDAAGGGPLAPRPRRRRSLRRLFSRFLLALGSRSRPGDSPPRPQPGHCDGDGEGG
FACAPGPVPAAPGSPGEERPPGPQPQLQLPAGDGARPPGAQGLKNHGNTCFMNAVVQCLS
NTDLLAEFLALGRYRAAPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGSQFQG
NSQHDALEFLLWLLDRVHEDLEGSSRGPVSEKLPPEATKTSENCLSPSAQLPLGQSFVQS
HFQAQYRSSLTCPHCLKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFPSKSQRFLRVGLAV
PILSTVAALRKMVAEEGGVPADEVILVELYPSGFQRSFFDEEDLNTIAEGDNVYAFQVPP
SPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFL
IREDRAVSWAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKDSRPLC
HWAVDRVLHLRRPGGPPHVKLAVEWDSSVKERLFGSLQEERAQDADSVWQQQQAHQQHSC
TLDECFQFYTKEEQLAQDDAWKCPHCQVLQQGMVKLSLWTLPDILIIHLKRFCQVGERRN
KLSTLVKFPLSGLNMAPHVAQRSTSPEAGLGPWPSWKQPDCLPTSYPLDFLYDLYAVCNH
HGNLQGGHYTAYCRNSLDGQWYSYDDSTVEPLREDEVNTRGAYILFYQKRNSIPPWSASS
SMRGSTSSSLSDHWLLRLGSHAGSTRGSLLSWSSAPCPSLPQVPDSPIFTNSLCNQEKGG
LEPRRLVRGVKGRSISMKAPTTSRAKQGPFKTMPLRWSFGSKEKPPGASVELVEYLESRR
RPRSTSQSIVSLLTGTAGEDEKSASPRSNVALPANSEDGGRAIERGPAGVPCPSAQPNHC
LAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQ
MGSKSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNERAEVSPQV
PPVSLVSGGLSPAMDGQAPGSPPALRIPEGLARGLGSRLERDVWSAPSSLRLPRKASRAP
RGSALGMSQRTVPGEQASYGTFQRVKYHTLSLGRKKTLPESSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70EL4	1.000	1.000	0.000	1123	1.000	1.000	Q70EL4.pdb.gz	UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens OX=9606 GN=USP43 PE=1 SV=2
2	AFDB:Q70CQ4	0.356	0.306	2.659E-88	1352	0.386	0.320	Q70CQ4.pdb.gz	UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens OX=9606 GN=USP31 PE=2 SV=2
3	PDB:3mhsA	0.248	0.588	9.390E-20	455	0.087	0.215	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
4	AFDB:B2RQC2	0.247	0.211	3.346E-18	1324	0.159	0.135	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
5	AFDB:Q9VRP5	0.253	0.273	2.959E-17	1038	0.156	0.169	Q9VRP5.pdb.gz	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
6	PDB:5cvnB	0.236	0.785	1.188E-15	321	0.081	0.283	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
7	PDB:4fjcE	0.221	0.542	1.405E-15	434	0.080	0.207	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
8	PDB:5k16B	0.221	0.704	3.842E-15	328	0.081	0.277	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
9	PDB:3ihpB	0.246	0.398	2.054E-14	681	0.081	0.134	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
10	PDB:5gjqx	0.218	0.642	1.817E-13	355	0.075	0.237	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
11	PDB:4wa6D	0.217	0.569	2.032E-13	415	0.076	0.205	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
12	PDB:7w3ax	0.212	0.458	2.032E-13	494	0.079	0.180	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
13	PDB:7ay1D	0.237	0.731	1.215E-12	341	0.076	0.249	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
14	PDB:7yxxA	0.232	0.151	1.215E-12	1754	0.079	0.051	7yxxA.pdb.gz
15	AFDB:Q8IWN7	0.071	0.042	4.051E-5	2400	0.133	0.062	Q8IWN7.pdb.gz	RP1L1_HUMAN Retinitis pigmentosa 1-like 1 protein OS=Homo sapiens OX=9606 GN=RP1L1 PE=1 SV=5
16	AFDB:O75128	0.071	0.064	2.709E-4	1261	0.101	0.090	O75128.pdb.gz	COBL_HUMAN Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2
17	AFDB:Q9ESU6	0.058	0.052	5.298E-4	1400	0.150	0.120	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
18	AFDB:F1R5H6	0.064	0.055	1.225E-3	1444	0.168	0.131	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
19	AFDB:E7F568	0.068	0.058	1.620E-3	1343	0.095	0.080	E7F568.pdb.gz	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
20	AFDB:Q17353	0.059	0.050	1.812E-3	1379	0.132	0.107	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q70CQ4	0.0	686	1352	0.327	0.271	UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens OX=9606 GN=USP31 PE=2 SV=2
2	Q70EL4	0.0	2281	1123	1.000	1.000	UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens OX=9606 GN=USP43 PE=1 SV=2
3	Q8WT44	2.03e-42	171	1178	0.155	0.148	UBPH_CAEEL Ubiquitin carboxyl-terminal hydrolase cyk-3 OS=Caenorhabditis elegans OX=6239 GN=cyk-3 PE=1 SV=1
4	Q13107	8.04e-42	169	963	0.074	0.086	UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=3
5	P35123	1.51e-41	168	962	0.074	0.086	UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus OX=10090 GN=Usp4 PE=1 SV=3
6	Q9Y4E8	5.28e-41	166	981	0.098	0.112	UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3
7	Q9R085	8.91e-41	165	952	0.081	0.096	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
8	Q8R5H1	1.14e-40	165	981	0.081	0.093	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
9	E7EZD6	1.92e-39	161	1009	0.082	0.091	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
10	H7C189	1.59e-35	146	621	0.076	0.137	H7C189_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=1
11	G5E9A6	7.11e-35	146	920	0.065	0.079	G5E9A6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=1
12	P51784	7.31e-35	146	963	0.065	0.076	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
13	Q5D006	2.00e-32	139	921	0.062	0.076	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
14	O60079	5.38e-31	134	979	0.079	0.091	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
15	O22207	6.85e-31	134	924	0.056	0.068	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
16	D3ZN39	1.59e-30	133	1081	0.055	0.057	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
17	Q80U87	2.12e-30	132	1080	0.055	0.057	UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus OX=10090 GN=Usp8 PE=1 SV=2
18	P40818	5.51e-30	131	1118	0.054	0.055	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
19	O94966	6.23e-30	131	1318	0.079	0.068	UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2
20	F1RCS0	9.16e-30	130	1436	0.076	0.059	F1RCS0_DANRE Ubiquitin carboxyl-terminal hydrolase 19 isoform X3 OS=Danio rerio OX=7955 GN=usp19 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	1.4e-58	210.2	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	1.9	19.6	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285199

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406046	0.748	DNA polymerase delta catalytic subunit
2	9606.ENSP00000304697	0.742	Polyubiquitin-B
3	9606.ENSP00000441543	0.742	Polyubiquitin-C
4	9606.ENSP00000457411	0.741	Ubiquitin carboxyl-terminal hydrolase 10
5	9606.ENSP00000368699	0.736	Ubiquitin-like protein ISG15
6	9606.ENSP00000272317	0.726	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000388107	0.718	Ubiquitin-60S ribosomal protein L40
8	9606.ENSP00000380178	0.717	Ubiquitin-conjugating enzyme E2 G1
9	9606.ENSP00000257548	0.708	Ubiquitin carboxyl-terminal hydrolase 30
10	9606.ENSP00000433146	0.696	Ubiquitin carboxyl-terminal hydrolase 47
11	9606.ENSP00000339389	0.692	OTU domain-containing protein 6A
12	9606.ENSP00000322570	0.688	DNA polymerase epsilon catalytic subunit A
13	9606.ENSP00000246190	0.670	N-terminal EF-hand calcium-binding protein 3
14	9606.ENSP00000216367	0.667	DNA polymerase epsilon subunit 2
15	9606.ENSP00000241436	0.658	DNA polymerase kappa
16	9606.ENSP00000258428	0.658	DNA repair protein REV1
17	9606.ENSP00000263966	0.658	Ubiquitin carboxyl-terminal hydrolase 13
18	9606.ENSP00000361310	0.658	DNA polymerase eta
19	9606.ENSP00000462664	0.658	DNA polymerase iota
20	9606.ENSP00000229268	0.657	Ubiquitin carboxyl-terminal hydrolase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008234	1.000	cysteine-type peptidase activity
GO:0101005	0.998	deubiquitinase activity
GO:0004843	0.988	cysteine-type deubiquitinase activity
GO:0005488	0.953	binding
GO:0005515	0.932	protein binding
GO:0019785	0.550	ISG15-specific peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0044238	0.992	primary metabolic process
GO:0009987	0.982	cellular process
GO:0044237	0.962	cellular metabolic process
GO:0044260	0.906	cellular macromolecule metabolic process
GO:0050896	0.870	response to stimulus
GO:0034641	0.856	cellular nitrogen compound metabolic process
GO:0006950	0.842	response to stress
GO:0051716	0.842	cellular response to stimulus
GO:0019538	0.760	protein metabolic process
GO:1901360	0.725	organic cyclic compound metabolic process
GO:0033554	0.719	cellular response to stress
GO:0090304	0.716	nucleic acid metabolic process
GO:0006974	0.704	cellular response to DNA damage stimulus
GO:0006259	0.668	DNA metabolic process
GO:0070646	0.618	protein modification by small protein removal
GO:0016579	0.578	protein deubiquitination
GO:0050789	0.460	regulation of biological process
GO:0006281	0.436	DNA repair
GO:0050794	0.391	regulation of cellular process
GO:0009059	0.334	macromolecule biosynthetic process
GO:0071897	0.311	DNA biosynthetic process
GO:0000731	0.300	DNA synthesis involved in DNA repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.823	cytoplasm
GO:0032991	0.448	protein-containing complex
GO:0005829	0.414	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.19.12	0.988	ubiquitinyl hydrolase 1.

[back to server]