StarFunc result for job id Q70HW3

User Input

>input (274 residues)
MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGS
FPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSA
STRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSW
QSAVCGAFAGGFAAAVTTPLDVAKTRITLAKAGSSTADGNVLSVLHGVWRSQGLAGLFAG
VFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70HW3	1.000	1.000	1.929E-35	274	1.000	1.000	Q70HW3.pdb.gz	SAMC_HUMAN Mitochondrial S-adenosylmethionine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A26 PE=1 SV=2
2	AFDB:Q5U680	0.978	0.978	5.947E-31	274	0.876	0.876	Q5U680.pdb.gz	SAMC_MOUSE Mitochondrial S-adenosylmethionine carrier protein OS=Mus musculus OX=10090 GN=Slc25a26 PE=1 SV=2
3	AFDB:P38921	0.867	0.838	5.948E-20	284	0.460	0.444	P38921.pdb.gz	PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PET8 PE=1 SV=1
4	AFDB:Q94AG6	0.873	0.741	6.867E-16	325	0.350	0.295	Q94AG6.pdb.gz	SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SAMC1 PE=1 SV=1
5	AFDB:O94344	0.796	0.842	9.333E-14	258	0.332	0.353	O94344.pdb.gz	YHMB_SCHPO Uncharacterized mitochondrial carrier C1271.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.11 PE=3 SV=1
6	AFDB:Q8L6Z2	0.856	0.728	9.740E-14	326	0.310	0.261	Q8L6Z2.pdb.gz	Q8L6Z2_ARATH At1g07030 OS=Arabidopsis thaliana OX=3702 GN=MIT2 PE=1 SV=1
7	AFDB:Q9FHX2	0.841	0.574	2.101E-13	412	0.321	0.214	Q9FHX2.pdb.gz	MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MFL1 PE=2 SV=1
8	AFDB:P10566	0.838	0.736	2.289E-13	314	0.281	0.245	P10566.pdb.gz	MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS3 PE=1 SV=4
9	AFDB:O64731	0.834	0.698	2.493E-13	331	0.296	0.245	O64731.pdb.gz	O64731_ARATH Mitochondrial substrate carrier family protein OS=Arabidopsis thaliana OX=3702 GN=MIT1 PE=1 SV=1
10	AFDB:P23500	0.820	0.744	2.715E-13	304	0.281	0.253	P23500.pdb.gz	MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS4 PE=1 SV=1
11	PDB:4c9qB	0.748	0.710	2.788E-7	290	0.215	0.203	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.741	0.698	1.906E-6	293	0.193	0.181	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.560	0.535	2.580E-5	292	0.201	0.188	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:7nd2A	0.145	0.131	2.209E-1	330	0.175	0.145	7nd2A.pdb.gz
15	PDB:7p5jA	0.133	0.098	2.978E-1	399	0.146	0.100	7p5jA.pdb.gz
16	PDB:7vh0A	0.163	0.164	3.108E-1	273	0.150	0.150	7vh0A.pdb.gz	Structural basis of the ligand binding and signaling mechanism of melatonin receptors.
17	PDB:3kcuA	0.231	0.242	3.533E-1	252	0.128	0.139	3kcuA.pdb.gz	Structure of the formate transporter FocA reveals a pentameric aquaporin-like channel
18	PDB:7p5cA	0.134	0.100	4.374E-1	392	0.157	0.110	7p5cA.pdb.gz
19	PDB:4rp9A	0.121	0.085	4.565E-1	451	0.128	0.078	4rp9A.pdb.gz	Crystal structure of a phosphorylation-coupled vitamin C transporter.
20	PDB:7zkwA	0.193	0.211	4.765E-1	243	0.106	0.119	7zkwA.pdb.gz	Structural basis for proton coupled cystine transport by cystinosin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q70HW3	0.0	553	274	1.000	1.000	SAMC_HUMAN Mitochondrial S-adenosylmethionine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A26 PE=1 SV=2
2	Q5U680	6.09e-168	467	274	0.876	0.876	SAMC_MOUSE Mitochondrial S-adenosylmethionine carrier protein OS=Mus musculus OX=10090 GN=Slc25a26 PE=1 SV=2
3	H7C430	2.82e-103	301	210	0.540	0.705	H7C430_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens OX=9606 GN=SLC25A26 PE=1 SV=2
4	P38921	4.97e-77	237	284	0.456	0.440	PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PET8 PE=1 SV=1
5	Q94AG6	1.68e-49	167	325	0.358	0.302	SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SAMC1 PE=1 SV=1
6	O94344	3.41e-41	144	258	0.336	0.357	YHMB_SCHPO Uncharacterized mitochondrial carrier C1271.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.11 PE=3 SV=1
7	Q03829	1.26e-33	127	368	0.365	0.272	MME1_YEAST Mitochondrial magnesium exporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MME1 PE=1 SV=1
8	Q9FHX2	1.49e-32	125	412	0.318	0.211	MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MFL1 PE=2 SV=1
9	G8B6G7	1.20e-26	107	318	0.307	0.264	G8B6G7_CANPC Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=SFC1 PE=3 SV=1
10	A0A1D8PNY6	1.88e-26	107	303	0.281	0.254	A0A1D8PNY6_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SFC1 PE=3 SV=1
11	P33303	5.77e-26	105	322	0.303	0.258	SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFC1 PE=1 SV=2
12	P23500	1.00e-25	105	304	0.285	0.257	MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS4 PE=1 SV=1
13	P10566	1.30e-25	105	314	0.296	0.258	MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS3 PE=1 SV=4
14	Q9DB41	3.33e-25	103	320	0.318	0.272	GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus OX=10090 GN=Slc25a18 PE=1 SV=4
15	Q505J6	8.21e-25	102	320	0.318	0.272	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
16	Q8VZP7	1.61e-24	104	823	0.274	0.091	Q8VZP7_ARATH Mitochondrial substrate carrier family protein OS=Arabidopsis thaliana OX=3702 GN=SAMTL PE=1 SV=1
17	Q9BQT8	9.76e-23	97.1	299	0.281	0.258	ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A21 PE=1 SV=1
18	O75746	3.09e-22	98.2	678	0.299	0.121	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
19	Q5A2T7	3.85e-22	95.9	325	0.277	0.234	Q5A2T7_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MRS4 PE=3 SV=1
20	P79110	5.80e-22	95.1	311	0.321	0.283	TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus OX=9913 GN=SLC25A1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	4.4e-46	166.1	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346955

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295899	0.774	THO complex subunit 7 homolog
2	9606.ENSP00000378935	0.731	Periphilin-1
3	9606.ENSP00000418695	0.670	Proteasome 26S subunit, non-ATPase 6
4	9606.ENSP00000315017	0.601	Mitochondrial ribosomal protein L1
5	9606.ENSP00000439585	0.592	Ataxin-7
6	9606.ENSP00000303584	0.553	HemK methyltransferase family member 2
7	9606.ENSP00000385450	0.545	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
8	9606.ENSP00000295902	0.539	Prickle planar cell polarity protein 2
9	9606.ENSP00000372445	0.538	Methyltransferase-like protein 17, mitochondrial
10	9606.ENSP00000273968	0.512	Protein preY, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015101	1.000	organic cation transmembrane transporter activity
GO:1901682	0.993	sulfur compound transmembrane transporter activity
GO:0008514	0.925	organic anion transmembrane transporter activity
GO:0005488	0.922	binding
GO:0005515	0.680	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.973	localization
GO:0009987	0.933	cellular process
GO:0006810	0.876	transport
GO:0071702	0.871	organic substance transport
GO:0008152	0.537	metabolic process
GO:0072348	0.508	sulfur compound transport
GO:0015695	0.397	organic cation transport
GO:0071704	0.347	organic substance metabolic process
GO:0044237	0.347	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.919	membrane
GO:0031090	0.803	organelle membrane
GO:0005740	0.552	mitochondrial envelope
GO:0070013	0.474	intracellular organelle lumen
GO:0005634	0.388	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]