StarFunc result for job id Q70IA6

User Input

>input (237 residues)
MDWLMGKSKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNT
TTFFHHINLQYSTISEFCTGETCQTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQK
LVTDEDVFPTKYGREFPSSFESLVRKICRHLFHVLAHIYWAHFKETLALELHGHLNTLYV
HFILFAREFNLLDPKETAIMDDLTEVLCSGAGGVHSGGSGDGAGSGGPGAQNHVKER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70IA6	1.000	1.000	9.938E-35	237	1.000	1.000	Q70IA6.pdb.gz	MOB2_HUMAN MOB kinase activator 2 OS=Homo sapiens OX=9606 GN=MOB2 PE=1 SV=1
2	AFDB:Q8IQG1	0.804	0.346	9.431E-18	566	0.426	0.178	Q8IQG1.pdb.gz	MOB2_DROME MOB kinase activator-like 2 OS=Drosophila melanogaster OX=7227 GN=Mob2 PE=1 SV=3
3	AFDB:O74558	0.796	0.774	2.070E-16	244	0.325	0.316	O74558.pdb.gz	MOB2_SCHPO Maintenance of ploidy protein mob2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mob2 PE=1 SV=1
4	AFDB:P43563	0.769	0.638	2.312E-15	287	0.278	0.230	P43563.pdb.gz	MOB2_YEAST CBK1 kinase activator protein MOB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOB2 PE=1 SV=2
5	AFDB:Q54CR8	0.726	0.795	2.943E-15	216	0.342	0.375	Q54CR8.pdb.gz	MOB1B_DICDI MOB kinase activator-like 1 homolog B OS=Dictyostelium discoideum OX=44689 GN=mobB PE=3 SV=1
6	PDB:5brkA	0.736	0.895	3.573E-15	194	0.338	0.412	5brkA.pdb.gz	Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
7	AFDB:Q54XJ0	0.713	0.792	6.070E-15	213	0.359	0.399	Q54XJ0.pdb.gz	MOB1A_DICDI MOB kinase activator-like 1 homolog A OS=Dictyostelium discoideum OX=44689 GN=mobA PE=3 SV=1
8	AFDB:Q5ABC6	0.789	0.602	8.930E-15	313	0.295	0.224	Q5ABC6.pdb.gz	MOB2_CANAL CBK1 kinase activator protein MOB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MOB2 PE=1 SV=1
9	AFDB:Q95RA8	0.710	0.767	1.593E-14	219	0.338	0.365	Q95RA8.pdb.gz	MOB1_DROME MOB kinase activator-like 1 OS=Drosophila melanogaster OX=7227 GN=mats PE=1 SV=1
10	AFDB:A0A2R8Q1Z8	0.713	0.770	1.933E-14	219	0.354	0.384	A0A2R8Q1Z8.pdb.gz
11	AFDB:O94360	0.704	0.792	7.465E-14	210	0.329	0.371	O94360.pdb.gz	MOB1_SCHPO Maintenance of ploidy protein mob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mob1 PE=1 SV=1
12	PDB:7k36H	0.486	0.631	3.435E-4	177	0.114	0.153	7k36H.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
13	PDB:5wg6A	0.108	0.057	2.469	517	0.055	0.025	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
14	PDB:7taoD	0.158	0.210	2.853	158	0.059	0.089	7taoD.pdb.gz	Cryo-EM of the Yeast V O Complex Reveals Distinct Binding Sites for Macrolide V-ATPase Inhibitors.
15	PDB:6hivBI	0.133	0.107	5.091	319	0.097	0.072	6hivBI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:7zxkC	0.163	0.211	5.091	166	0.101	0.145	7zxkC.pdb.gz
17	PDB:6ygbB	0.170	0.076	5.343	725	0.169	0.055	6ygbB.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
18	PDB:7mq8SY	0.170	0.169	5.607	238	0.097	0.097	7mq8SY.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:2k7wA	0.174	0.204	6.175	192	0.076	0.094	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
20	PDB:4nq0A	0.200	0.190	6.175	254	0.101	0.094	4nq0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q70IA6	0.0	500	237	1.000	1.000	MOB2_HUMAN MOB kinase activator 2 OS=Homo sapiens OX=9606 GN=MOB2 PE=1 SV=1
2	Q8VI63	1.16e-167	463	235	0.920	0.928	MOB2_MOUSE MOB kinase activator 2 OS=Mus musculus OX=10090 GN=Mob2 PE=1 SV=1
3	Q8IQG1	3.41e-60	200	566	0.409	0.171	MOB2_DROME MOB kinase activator-like 2 OS=Drosophila melanogaster OX=7227 GN=Mob2 PE=1 SV=3
4	Q54XJ0	1.42e-52	171	213	0.376	0.418	MOB1A_DICDI MOB kinase activator-like 1 homolog A OS=Dictyostelium discoideum OX=44689 GN=mobA PE=3 SV=1
5	Q7L9L4	1.79e-50	166	216	0.367	0.403	MOB1B_HUMAN MOB kinase activator 1B OS=Homo sapiens OX=9606 GN=MOB1B PE=1 SV=3
6	Q95RA8	7.35e-50	164	219	0.371	0.402	MOB1_DROME MOB kinase activator-like 1 OS=Drosophila melanogaster OX=7227 GN=mats PE=1 SV=1
7	Q9H8S9	8.26e-50	164	216	0.363	0.398	MOB1A_HUMAN MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A PE=1 SV=4
8	Q7ZV70	1.29e-49	163	216	0.367	0.403	Q7ZV70_DANRE MOB kinase activator 1A OS=Danio rerio OX=7955 GN=mobkl1b PE=1 SV=1
9	Q54CR8	8.20e-49	161	216	0.329	0.361	MOB1B_DICDI MOB kinase activator-like 1 homolog B OS=Dictyostelium discoideum OX=44689 GN=mobB PE=3 SV=1
10	O74558	9.75e-49	162	244	0.321	0.311	MOB2_SCHPO Maintenance of ploidy protein mob2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mob2 PE=1 SV=1
11	Q8GYX0	7.02e-48	159	215	0.359	0.395	MOB1B_ARATH MOB kinase activator-like 1B OS=Arabidopsis thaliana OX=3702 GN=MOB1B PE=1 SV=1
12	Q9FHI1	5.91e-47	156	215	0.350	0.386	MOB1A_ARATH MOB kinase activator-like 1A OS=Arabidopsis thaliana OX=3702 GN=MOB1A PE=1 SV=1
13	O94360	6.35e-46	154	210	0.321	0.362	MOB1_SCHPO Maintenance of ploidy protein mob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mob1 PE=1 SV=1
14	F4K495	7.46e-44	149	216	0.308	0.338	MOB2A_ARATH MOB kinase activator-like 2A OS=Arabidopsis thaliana OX=3702 GN=MOB2A PE=2 SV=1
15	Q949G5	3.32e-43	147	215	0.312	0.344	MOB1A_MEDSF MOB kinase activator-like 1A OS=Medicago sativa subsp. falcata OX=3878 GN=MOB1-A PE=2 SV=2
16	Q2WBN3	4.49e-43	146	215	0.316	0.349	MOB1B_MEDSF MOB kinase activator-like 1B OS=Medicago sativa subsp. falcata OX=3878 GN=MOB1-B PE=2 SV=1
17	P43563	2.55e-38	136	287	0.295	0.244	MOB2_YEAST CBK1 kinase activator protein MOB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOB2 PE=1 SV=2
18	Q5ABC6	3.56e-38	137	313	0.300	0.227	MOB2_CANAL CBK1 kinase activator protein MOB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MOB2 PE=1 SV=1
19	Q70IA8	5.04e-38	134	216	0.270	0.296	MOB3C_HUMAN MOB kinase activator 3C OS=Homo sapiens OX=9606 GN=MOB3C PE=1 SV=1
20	P40484	7.26e-35	128	314	0.291	0.220	MOB1_YEAST DBF2 kinase activator protein MOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOB1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03637 Mob1_phocein	2e-60	215.2	Mob1/phocein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000006175

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000013265	0.914	Large tumor suppressor kinase 1
2	60711.ENSCSAP00000014145	0.885	Uncharacterized protein
3	60711.ENSCSAP00000003911	0.811	Belongs to the protein kinase superfamily.
4	60711.ENSCSAP00000008506	0.801	Serine/threonine kinase 3
5	60711.ENSCSAP00000010402	0.801	Serine/threonine kinase 4
6	60711.ENSCSAP00000006513	0.799	Belongs to the protein kinase superfamily.
7	60711.ENSCSAP00000007620	0.676	MOB family member 4, phocein
8	60711.ENSCSAP00000011230	0.676	Salvador family WW domain containing protein 1
9	60711.ENSCSAP00000014820	0.640	Yes-associated protein 1
10	60711.ENSCSAP00000002844	0.612	Microtubule associated serine/threonine kinase 1
11	60711.ENSCSAP00000003494	0.595	annotation not available
12	60711.ENSCSAP00000006357	0.576	Growth arrest-specific 7
13	60711.ENSCSAP00000002903	0.557	annotation not available
14	60711.ENSCSAP00000008998	0.511	TSEN15 tRNA splicing endonuclease subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.329	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0051174	0.917	regulation of phosphorus metabolic process
GO:0080090	0.912	regulation of primary metabolic process
GO:0019220	0.853	regulation of phosphate metabolic process
GO:0060255	0.851	regulation of macromolecule metabolic process
GO:0031325	0.837	positive regulation of cellular metabolic process
GO:0071840	0.829	cellular component organization or biogenesis
GO:0031399	0.826	regulation of protein modification process
GO:0051173	0.757	positive regulation of nitrogen compound metabolic process
GO:0031344	0.747	regulation of cell projection organization
GO:0016043	0.735	cellular component organization
GO:0030029	0.702	actin filament-based process
GO:0120035	0.693	regulation of plasma membrane bounded cell projection organization
GO:0010604	0.687	positive regulation of macromolecule metabolic process
GO:0010562	0.680	positive regulation of phosphorus metabolic process
GO:0010976	0.615	positive regulation of neuron projection development
GO:0006996	0.575	organelle organization
GO:0031401	0.536	positive regulation of protein modification process
GO:0045937	0.458	positive regulation of phosphate metabolic process
GO:0007010	0.414	cytoskeleton organization
GO:0042325	0.356	regulation of phosphorylation
GO:0001932	0.354	regulation of protein phosphorylation
GO:0050896	0.314	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0031981	0.996	nuclear lumen
GO:0005654	0.990	nucleoplasm
GO:0043232	0.960	intracellular non-membrane-bounded organelle
GO:0005730	0.415	nucleolus
GO:0120025	0.342	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]