StarFunc result for job id Q70J99

User Input

>input (1090 residues)
MATLLSHPQQRPPFLRQAIKIRRRRVRDLQDPPPQMAPEIQPPSHHFSPEQRALLYEDAL
YTVLHRLGHPEPNHVTEASELLRYLQEAFHVEPEEHQQTLQRVRELEKPIFCLKATVKQA
KGILGKDVSGFSDPYCLLGIEQGVGVPGGSPGSRHRQKAVVRHTIPEEETHRTQVITQTL
NPVWDETFILEFEDITNASFHLDMWDLDTVESVRQKLGELTDLHGLRRIFKEARKDKGQD
DFLGNVVLRLQDLRCREDQWYPLEPRTETYPDRGQCHLQFQLIHKRRATSASRSQPSYTV
HLHLLQQLVSHEVTQHEAGSTSWDGSLSPQAATVLFLHATQKDLSDFHQSMAQWLAYSRL
YQSLEFPSSCLLHPITSIEYQWIQGRLKAEQQEELAASFSSLLTYGLSLIRRFRSVFPLS
VSDSPARLQSLLRVLVQMCKMKAFGELCPNTAPLPQLVTEALQTGTTEWFHLKQQHHQPM
VQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDH
TTVVGDVVSPEMGESLFQLYISLKELCQLRMSSSERDGVLALDNFHRWFQPAIPSWLQKT
YNEALARVQRAVQMDELVPLGELTKHSTSAVDLSTCFAQISHTARQLDWPDPEEAFMITV
KFVEDTCRLALVYCSLIKARARELSSGQKDQGQAANMLCVVVNDMEQLRLVIGKLPAQLA
WEALEQRVGAVLEQGQLQNTLHAQLQSALAGLGHEIRTGVRTLAEQLEVGIAKHIQKLVG
VRESVLPEDAILPLMKFLEVELCYMNTNLVQENFSSLLTLLWTHTLTVLVEAAASQRSSS
LASNRLKIALQNLEICFHAEGCGLPPKALHTATFQALQRDLELQAASSRELIRKYFCSRI
QQQAETTSEELGAVTVKASYRASEQKLRVELLSASSLLPLDSNGSSDPFVQLTLEPRHEF
PELAARETQKHKKDLHPLFDETFEFLVPAEPCRKAGACLLLTVLDYDTLGADDLEGEAFL
PLREVPGLSGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRAKQ
ASQHALRPAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70J99	1.000	1.000	0.000	1090	1.000	1.000	Q70J99.pdb.gz	UN13D_HUMAN Protein unc-13 homolog D OS=Homo sapiens OX=9606 GN=UNC13D PE=1 SV=1
2	AFDB:Q9R189	0.919	0.921	0.000	1088	0.872	0.873	Q9R189.pdb.gz	UN13D_RAT Protein unc-13 homolog D OS=Rattus norvegicus OX=10116 GN=Unc13d PE=1 SV=1
3	AFDB:O94812	0.626	0.579	3.586E-70	1187	0.334	0.307	O94812.pdb.gz	BAIP3_HUMAN BAI1-associated protein 3 OS=Homo sapiens OX=9606 GN=BAIAP3 PE=1 SV=2
4	AFDB:Q80TT2	0.590	0.570	5.104E-66	1134	0.322	0.310	Q80TT2.pdb.gz	BAIP3_MOUSE BAI1-associated protein 3 OS=Mus musculus OX=10090 GN=Baiap3 PE=1 SV=4
5	AFDB:Q9VBY8	0.577	0.552	4.657E-54	1153	0.223	0.211	Q9VBY8.pdb.gz	UN13B_DROME Protein unc-13 homolog 4B OS=Drosophila melanogaster OX=7227 GN=stac PE=1 SV=5
6	AFDB:Q9Z1N9	0.311	0.235	9.012E-40	1602	0.190	0.129	Q9Z1N9.pdb.gz	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2
7	AFDB:Q62769	0.313	0.227	5.165E-39	1622	0.190	0.128	Q62769.pdb.gz	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
8	AFDB:Q9UPW8	0.314	0.218	6.299E-39	1703	0.177	0.113	Q9UPW8.pdb.gz	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
9	AFDB:Q62768	0.309	0.213	5.586E-38	1735	0.181	0.114	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
10	AFDB:Q8NB66	0.302	0.176	7.375E-38	2214	0.172	0.084	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
11	PDB:3pfqA	0.101	0.208	1.766E-7	523	0.029	0.061	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:5ixcA	0.103	0.163	1.908E-5	684	0.024	0.038	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	PDB:1cjyA	0.103	0.172	4.220E-5	633	0.039	0.068	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:5izrC	0.100	0.163	6.529E-5	659	0.023	0.038	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:2b7mB	0.189	0.325	8.968E-5	523	0.056	0.117	2b7mB.pdb.gz
16	PDB:4rj9A	0.099	0.623	9.331E-5	161	0.030	0.205	4rj9A.pdb.gz
17	PDB:5iz5B	0.107	0.154	1.051E-4	746	0.025	0.036	5iz5B.pdb.gz
18	PDB:7lq1A	0.095	0.107	1.502E-4	950	0.090	0.103	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
19	PDB:5a50A	0.103	0.635	1.983E-4	165	0.028	0.188	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:7dkhI	0.106	0.118	1.983E-4	914	0.080	0.095	7dkhI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RUP2	0.0	1885	1085	0.877	0.881	UN13D_MOUSE Protein unc-13 homolog D OS=Mus musculus OX=10090 GN=Unc13d PE=1 SV=2
2	K7EN81	0.0	640	311	0.285	1.000	K7EN81_HUMAN Unc-13 homolog D (Fragment) OS=Homo sapiens OX=9606 GN=UNC13D PE=1 SV=2
3	Q70J99	0.0	2231	1090	1.000	1.000	UN13D_HUMAN Protein unc-13 homolog D OS=Homo sapiens OX=9606 GN=UNC13D PE=1 SV=1
4	Q9R189	0.0	1883	1088	0.872	0.873	UN13D_RAT Protein unc-13 homolog D OS=Rattus norvegicus OX=10116 GN=Unc13d PE=1 SV=1
5	O94812	3.90e-175	547	1187	0.343	0.315	BAIP3_HUMAN BAI1-associated protein 3 OS=Homo sapiens OX=9606 GN=BAIAP3 PE=1 SV=2
6	Q80TT2	2.28e-173	541	1150	0.335	0.317	BAIP3_MOUSE BAI1-associated protein 3 OS=Mus musculus OX=10090 GN=Baiap3 PE=1 SV=4
7	K7EMK8	2.99e-101	318	188	0.140	0.814	K7EMK8_HUMAN Unc-13 homolog D (Fragment) OS=Homo sapiens OX=9606 GN=UNC13D PE=1 SV=1
8	Q9VBY8	1.52e-85	303	1153	0.240	0.227	UN13B_DROME Protein unc-13 homolog 4B OS=Drosophila melanogaster OX=7227 GN=stac PE=1 SV=5
9	P27715	5.29e-34	144	2155	0.230	0.116	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
10	G5EDN9	7.42e-34	144	1819	0.230	0.138	G5EDN9_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=1
11	Q9Z1N9	1.50e-30	133	1602	0.223	0.152	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2
12	O14795	8.77e-30	130	1591	0.221	0.151	UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2
13	Q62769	3.56e-28	125	1622	0.222	0.149	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
14	Q4KUS2	8.80e-20	98.6	1712	0.208	0.133	UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus OX=10090 GN=Unc13a PE=1 SV=3
15	Q8T049	4.36e-19	96.3	1508	0.122	0.088	Q8T049_DROME LD28927p OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
16	Q8IM86	1.89e-18	94.4	3183	0.122	0.042	Q8IM86_DROME Unc-13, isoform B OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
17	H9XVP2	1.99e-18	94.4	3186	0.122	0.042	H9XVP2_DROME Unc-13, isoform E OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
18	Q9UPW8	3.20e-18	93.2	1703	0.207	0.133	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
19	Q9V483	4.48e-18	93.2	2874	0.121	0.046	Q9V483_DROME Unc-13, isoform C OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=4
20	X2J9E1	4.67e-18	92.8	2871	0.121	0.046	X2J9E1_DROME Unc-13, isoform G OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	9.4e-25	98.2	C2 domain
2	PF06292 MUN	0.00015	32.5	MUN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000207549

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379601	0.996	Ras-related protein Rab-27A
2	9606.ENSP00000356540	0.923	Syntaxin-11
3	9606.ENSP00000413606	0.889	Syntaxin-binding protein 2
4	9606.ENSP00000261890	0.842	Ras-related protein Rab-11A
5	9606.ENSP00000262094	0.794	Ras-related protein Rab-27B
6	9606.ENSP00000374443	0.788	Lysosomal-trafficking regulator
7	9606.ENSP00000360181	0.757	SH2 domain-containing protein 1A
8	9606.ENSP00000398568	0.730	Perforin-1
9	9606.ENSP00000349629	0.724	Lipopolysaccharide-responsive and beige-like anchor protein
10	9606.ENSP00000357801	0.709	Protein S100-A10
11	9606.ENSP00000386665	0.702	Four and a half LIM domains protein 2
12	9606.ENSP00000361704	0.693	CTP synthase 1
13	9606.ENSP00000267512	0.690	Ras-related protein Rab-15
14	9606.ENSP00000255194	0.681	AP-3 complex subunit beta-1
15	9606.ENSP00000263863	0.653	Granulysin
16	9606.ENSP00000356918	0.652	Syntaxin-7
17	9606.ENSP00000395220	0.614	Synaptotagmin-like protein 5
18	9606.ENSP00000440167	0.614	Ras-related protein Rab-19
19	9606.ENSP00000264605	0.603	Melanophilin
20	9606.ENSP00000466121	0.603	Fanconi anemia core complex-associated protein 24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.915	enzyme binding
GO:0031267	0.882	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0051179	0.986	localization
GO:0046903	0.984	secretion
GO:0016192	0.975	vesicle-mediated transport
GO:0006887	0.967	exocytosis
GO:0017157	0.941	regulation of exocytosis
GO:0048518	0.925	positive regulation of biological process
GO:0045055	0.921	regulated exocytosis
GO:0048522	0.910	positive regulation of cellular process
GO:0016043	0.856	cellular component organization
GO:1903305	0.849	regulation of regulated secretory pathway
GO:0045921	0.849	positive regulation of exocytosis
GO:0050896	0.835	response to stimulus
GO:0050776	0.828	regulation of immune response
GO:0044085	0.775	cellular component biogenesis
GO:1903307	0.768	positive regulation of regulated secretory pathway
GO:0002376	0.727	immune system process
GO:0023051	0.690	regulation of signaling
GO:0010646	0.689	regulation of cell communication
GO:0002699	0.659	positive regulation of immune effector process
GO:0002703	0.635	regulation of leukocyte mediated immunity
GO:0051239	0.632	regulation of multicellular organismal process
GO:0002694	0.619	regulation of leukocyte activation
GO:0043300	0.605	regulation of leukocyte degranulation
GO:0032501	0.566	multicellular organismal process
GO:0002886	0.522	regulation of myeloid leukocyte mediated immunity
GO:0051641	0.516	cellular localization
GO:0033003	0.502	regulation of mast cell activation
GO:0022607	0.414	cellular component assembly
GO:0051649	0.325	establishment of localization in cell
GO:0001775	0.324	cell activation
GO:0002252	0.308	immune effector process
GO:0045321	0.304	leukocyte activation
GO:0006950	0.303	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031982	0.999	vesicle
GO:0012505	0.998	endomembrane system
GO:0005829	0.998	cytosol
GO:0070013	0.993	intracellular organelle lumen
GO:0099503	0.988	secretory vesicle
GO:0005576	0.979	extracellular region
GO:0030141	0.977	secretory granule
GO:0016020	0.972	membrane
GO:0071944	0.925	cell periphery
GO:0005764	0.887	lysosome
GO:0030133	0.732	transport vesicle
GO:0005886	0.693	plasma membrane
GO:0005615	0.676	extracellular space
GO:1903561	0.645	extracellular vesicle
GO:0031090	0.644	organelle membrane
GO:0070062	0.635	extracellular exosome
GO:0030135	0.628	coated vesicle
GO:0030136	0.614	clathrin-coated vesicle
GO:0070382	0.606	exocytic vesicle
GO:0005766	0.600	primary lysosome
GO:0012506	0.591	vesicle membrane
GO:0042582	0.586	azurophil granule
GO:0030659	0.526	cytoplasmic vesicle membrane
GO:0005634	0.496	nucleus
GO:0005768	0.386	endosome
GO:0033093	0.364	Weibel-Palade body
GO:0034774	0.362	secretory granule lumen
GO:0030054	0.315	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]