StarFunc result for job id Q70SY1

User Input

>input (520 residues)
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDF
PSTSIKTEPVTDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6QDP7	0.418	0.417	2.359E-64	521	0.910	0.908	Q6QDP7.pdb.gz	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
2	AFDB:A1L224	0.315	0.316	1.960E-36	519	0.517	0.518	A1L224.pdb.gz	CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio OX=7955 GN=creb3l2 PE=2 SV=1
3	AFDB:Q66HA2	0.335	0.335	2.154E-23	520	0.429	0.429	Q66HA2.pdb.gz	CR3L1_RAT Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Creb3l1 PE=2 SV=1
4	AFDB:O44743	0.220	0.171	3.348E-7	690	0.212	0.159	O44743.pdb.gz	LE607_CAEEL CREB-H transcription factor homolog let-607 OS=Caenorhabditis elegans OX=6239 GN=let-607 PE=2 SV=2
5	AFDB:O35451	0.136	0.105	6.554E-7	699	0.206	0.153	O35451.pdb.gz	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
6	AFDB:Q5RH85	0.111	0.091	3.073E-6	653	0.179	0.142	Q5RH85.pdb.gz	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
7	AFDB:F6VAN0	0.119	0.099	4.020E-6	656	0.183	0.145	F6VAN0.pdb.gz	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
8	AFDB:P18850	0.122	0.102	1.885E-5	670	0.194	0.151	P18850.pdb.gz	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
9	AFDB:B7SBD2	0.074	0.069	1.730E-4	577	0.133	0.120	B7SBD2.pdb.gz	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
10	AFDB:Q9HCS4	0.087	0.079	2.961E-4	588	0.162	0.143	Q9HCS4.pdb.gz	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
11	PDB:5oayA	0.046	0.222	2.793	76	0.015	0.105	5oayA.pdb.gz	Structure of a Wbl protein and implications for NO sensing by M. tuberculosis.
12	PDB:7mqaSS	0.068	0.098	8.181	350	0.067	0.100	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6QDP7	0.0	840	521	0.910	0.908	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
2	Q70SY1	0.0	1049	520	1.000	1.000	CR3L2_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Homo sapiens OX=9606 GN=CREB3L2 PE=1 SV=3
3	Q8BH52	0.0	869	521	0.912	0.910	CR3L2_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Mus musculus OX=10090 GN=Creb3l2 PE=1 SV=1
4	A1L224	5.16e-144	426	519	0.540	0.541	CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio OX=7955 GN=creb3l2 PE=2 SV=1
5	Q96BA8	1.09e-85	276	519	0.400	0.401	CR3L1_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Homo sapiens OX=9606 GN=CREB3L1 PE=1 SV=1
6	Q9Z125	8.15e-85	273	519	0.400	0.401	CR3L1_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Mus musculus OX=10090 GN=Creb3l1 PE=1 SV=2
7	Q66HA2	3.46e-83	269	520	0.387	0.387	CR3L1_RAT Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Creb3l1 PE=2 SV=1
8	Q68CJ9	1.76e-35	140	461	0.137	0.154	CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens OX=9606 GN=CREB3L3 PE=1 SV=2
9	Q8TEY5	2.13e-33	133	395	0.140	0.185	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
10	Q91XE9	1.55e-32	132	479	0.129	0.140	CR3L3_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Mus musculus OX=10090 GN=Creb3l3 PE=1 SV=1
11	Q9D2A5	3.12e-31	126	370	0.138	0.195	CR3L4_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Mus musculus OX=10090 GN=Creb3l4 PE=1 SV=1
12	P29747	7.26e-30	124	516	0.194	0.196	CREBA_DROME Cyclic AMP response element-binding protein A OS=Drosophila melanogaster OX=7227 GN=CrebA PE=1 SV=2
13	O43889	3.39e-29	120	371	0.127	0.178	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
14	Q4JFH9	1.04e-28	119	351	0.112	0.165	CRH2_CAEEL CREB homolog crh-2 OS=Caenorhabditis elegans OX=6239 GN=crh-2 PE=2 SV=3
15	Q61817	1.65e-21	99.0	404	0.096	0.124	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
16	O44743	1.70e-15	81.6	690	0.106	0.080	LE607_CAEEL CREB-H transcription factor homolog let-607 OS=Caenorhabditis elegans OX=6239 GN=let-607 PE=2 SV=2
17	Q99941	5.84e-10	64.3	703	0.112	0.083	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
18	O35451	1.28e-09	63.2	699	0.112	0.083	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
19	Q54WN7	1.86e-08	59.3	631	0.060	0.049	BZPF_DICDI Probable basic-leucine zipper transcription factor F OS=Dictyostelium discoideum OX=44689 GN=bzpF PE=3 SV=1
20	P15337	9.82e-07	53.1	327	0.060	0.095	CREB1_RAT Cyclic AMP-responsive element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Creb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	6.5e-11	53.5	bZIP transcription factor
2	PF07716 bZIP_2	4.2e-05	34.8	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.0093	27.8	bZIP Maf transcription factor
4	PF14661 HAUS6_N	8.6e+02	10.9	HAUS augmin-like complex subunit 6 N-terminus
5	PF15871 JMY	5.2e+02	11.3	Junction-mediating and -regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368798	0.961	Membrane-bound transcription factor site-2 protease
2	9606.ENSP00000344223	0.960	Membrane-bound transcription factor site-1 protease
3	9606.ENSP00000262053	0.921	Cyclic AMP-dependent transcription factor ATF-1
4	9606.ENSP00000342136	0.919	Cyclic AMP-responsive element-binding protein 3
5	9606.ENSP00000336790	0.859	Cyclic AMP-dependent transcription factor ATF-4
6	9606.ENSP00000350359	0.858	Cyclic AMP-responsive element-binding protein 5
7	9606.ENSP00000481956	0.858	Cyclic AMP-responsive element-binding protein 3-like protein 1
8	9606.ENSP00000078445	0.856	Cyclic AMP-responsive element-binding protein 3-like protein 3
9	9606.ENSP00000387699	0.856	Cyclic AMP-responsive element-binding protein 1
10	9606.ENSP00000263253	0.847	Histone acetyltransferase p300
11	9606.ENSP00000357596	0.847	Cyclic AMP-responsive element-binding protein 3-like protein 4
12	9606.ENSP00000364349	0.844	Cyclic AMP-dependent transcription factor ATF-6 beta
13	9606.ENSP00000262367	0.843	CREB-binding protein
14	9606.ENSP00000295731	0.828	Indian hedgehog protein
15	9606.ENSP00000357622	0.823	CREB-regulated transcription coactivator 2
16	9606.ENSP00000264110	0.810	Cyclic AMP-dependent transcription factor ATF-2
17	9606.ENSP00000280551	0.809	Protein transport protein Sec24D
18	9606.ENSP00000324806	0.802	Glycogen synthase kinase-3 beta
19	9606.ENSP00000252996	0.800	Transcription initiation factor TFIID subunit 4
20	9606.ENSP00000269142	0.800	Transcription initiation factor TFIID subunit 4B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.996	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.993	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.960	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.992	cellular response to stimulus
GO:0009891	0.986	positive regulation of biosynthetic process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0033554	0.971	cellular response to stress
GO:0048522	0.963	positive regulation of cellular process
GO:0010604	0.913	positive regulation of macromolecule metabolic process
GO:0031325	0.857	positive regulation of cellular metabolic process
GO:0051173	0.809	positive regulation of nitrogen compound metabolic process
GO:0010557	0.781	positive regulation of macromolecule biosynthetic process
GO:0031328	0.781	positive regulation of cellular biosynthetic process
GO:0045935	0.777	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.724	positive regulation of RNA metabolic process
GO:0034976	0.700	response to endoplasmic reticulum stress
GO:0045893	0.634	positive regulation of DNA-templated transcription
GO:0006357	0.434	regulation of transcription by RNA polymerase II
GO:0032502	0.355	developmental process
GO:0032501	0.355	multicellular organismal process
GO:0048856	0.353	anatomical structure development
GO:0048519	0.346	negative regulation of biological process
GO:0048523	0.335	negative regulation of cellular process
GO:0007154	0.334	cell communication
GO:0023052	0.324	signaling
GO:0007165	0.308	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005654	0.998	nucleoplasm
GO:0016020	0.997	membrane
GO:0005829	0.995	cytosol
GO:0031090	0.969	organelle membrane
GO:0043232	0.954	intracellular non-membrane-bounded organelle
GO:0098588	0.863	bounding membrane of organelle
GO:0031984	0.792	organelle subcompartment
GO:0005794	0.347	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]