StarFunc result for job id Q70YC5

User Input

>input (407 residues)
MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLT
KCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAE
RPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRI
DKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESE
EELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGF
VRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPA
KAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70YC5	1.000	1.000	2.571E-54	407	1.000	1.000	Q70YC5.pdb.gz	ZN365_HUMAN Protein ZNF365 OS=Homo sapiens OX=9606 GN=ZNF365 PE=1 SV=3
2	AFDB:Q5PQS2	0.594	0.593	2.724E-44	408	0.862	0.860	Q5PQS2.pdb.gz	ZN365_RAT Protein ZNF365 OS=Rattus norvegicus OX=10116 GN=Znf365 PE=1 SV=1
3	AFDB:A0A2R8PWQ4	0.325	0.400	3.606E-10	326	0.283	0.353	A0A2R8PWQ4.pdb.gz
4	AFDB:E7FDA3	0.355	0.406	1.040E-9	345	0.295	0.348	E7FDA3.pdb.gz	E7FDA3_DANRE Protein ZNF365 OS=Danio rerio OX=7955 GN=znf365 PE=4 SV=1
5	AFDB:Q3UHI0	0.068	0.039	4.282E-1	833	0.118	0.058	Q3UHI0.pdb.gz	CCSE2_MOUSE Serine-rich coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ccser2 PE=1 SV=1
6	AFDB:Q9LES3	0.115	0.148	4.282E-1	297	0.093	0.128	Q9LES3.pdb.gz	AI5L2_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=DPBF3 PE=1 SV=1
7	AFDB:O43889	0.142	0.153	8.082E-1	371	0.143	0.156	O43889.pdb.gz	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
8	AFDB:Q7PCC6	0.127	0.198	9.988E-1	234	0.084	0.145	Q7PCC6.pdb.gz	FDP_ARATH bZIP transcription factor 27 OS=Arabidopsis thaliana OX=3702 GN=FDP PE=1 SV=1
9	AFDB:Q9SX27	0.104	0.096	1.072	452	0.079	0.071	Q9SX27.pdb.gz	PAN_ARATH Transcription factor PERIANTHIA OS=Arabidopsis thaliana OX=3702 GN=PAN PE=1 SV=1
10	AFDB:Q99NC2	0.218	0.125	1.234	804	0.179	0.091	Q99NC2.pdb.gz	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
11	PDB:7ungi	0.071	0.111	7.088	250	0.088	0.144	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5PQS2	0.0	684	408	0.862	0.860	ZN365_RAT Protein ZNF365 OS=Rattus norvegicus OX=10116 GN=Znf365 PE=1 SV=1
2	Q70YC5	0.0	841	407	1.000	1.000	ZN365_HUMAN Protein ZNF365 OS=Homo sapiens OX=9606 GN=ZNF365 PE=1 SV=3
3	Q8BG89	0.0	675	408	0.850	0.848	ZN365_MOUSE Protein ZNF365 OS=Mus musculus OX=10090 GN=Znf365 PE=1 SV=1
4	E7FDA3	1.92e-44	159	345	0.265	0.313	E7FDA3_DANRE Protein ZNF365 OS=Danio rerio OX=7955 GN=znf365 PE=4 SV=1
5	Q8TF61	1.22e-22	102	875	0.147	0.069	FBX41_HUMAN F-box only protein 41 OS=Homo sapiens OX=9606 GN=FBXO41 PE=2 SV=5
6	Q8IDX6	0.012	40.4	3130	0.091	0.012	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
7	Q91YU6	0.021	39.7	671	0.098	0.060	LZTS2_MOUSE Leucine zipper putative tumor suppressor 2 OS=Mus musculus OX=10090 GN=Lzts2 PE=1 SV=3
8	P13496	1.3	33.9	1265	0.098	0.032	DCTN1_DROME Dynactin subunit 1 OS=Drosophila melanogaster OX=7227 GN=DCTN1-p150 PE=1 SV=2
9	Q99NC2	2.4	33.1	804	0.079	0.040	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
10	Q4VCS5	2.5	33.1	1084	0.096	0.036	AMOT_HUMAN Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
11	Q9URY2	2.5	32.7	474	0.111	0.095	ALP7_SCHPO Microtubule protein alp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp7 PE=1 SV=1
12	B5DFK5	3.2	32.7	1068	0.091	0.035	B5DFK5_RAT Hip1r protein OS=Rattus norvegicus OX=10116 GN=Hip1r PE=2 SV=1
13	F1LML7	3.2	32.7	1069	0.091	0.035	F1LML7_RAT Huntingtin interacting protein 1 related OS=Rattus norvegicus OX=10116 GN=Hip1r PE=1 SV=1
14	Q61572	3.3	32.3	553	0.042	0.031	FOXC1_MOUSE Forkhead box protein C1 OS=Mus musculus OX=10090 GN=Foxc1 PE=1 SV=3
15	E7ERM3	3.4	32.3	852	0.096	0.046	E7ERM3_HUMAN Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
16	A6NP16	3.9	32.3	597	0.096	0.065	A6NP16_HUMAN Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
17	E9PR38	4.2	32.3	944	0.074	0.032	E9PR38_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
18	Q5VT25	4.8	32.0	1732	0.064	0.015	MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens OX=9606 GN=CDC42BPA PE=1 SV=1
19	Q14671	5.2	32.0	1186	0.076	0.026	PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3
20	Q5J2I5	5.3	31.6	478	0.042	0.036	Q5J2I5_DANRE Bloody fingers OS=Danio rerio OX=7955 GN=zgc:123026 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00195 Chal_sti_synt_N	98	13.8	Chalcone and stilbene synthases, N-terminal domain
2	PF01093 Clusterin	34	14.9	Clusterin
3	PF02601 Exonuc_VII_L	68	14.5	Exonuclease VII, large subunit
4	PF04632 FUSC	3e+02	11.4	Fusaric acid resistance protein family
5	PF09457 RBD-FIP	61	15.0	FIP domain
6	PF00096 zf-C2H2	3.1e+02	13.3	Zinc finger, C2H2 type
7	PF13894 zf-C2H2_4	4.2e+02	13.3	C2H2-type zinc finger
8	PF16278 zf-C2HE	5e+02	12.6	C2HE / C2H2 / C2HC zinc-binding finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003830368.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008963752.1	0.686	nudE neurodevelopment protein 1
2	9597.XP_008976435.1	0.681	Disrupted in schizophrenia 1 protein
3	9597.XP_008976436.1	0.681	Disrupted in schizophrenia 1 protein
4	9597.XP_008960115.1	0.654	Suppressor of SWI4 1 homolog
5	9597.XP_003830206.1	0.501	Belongs to the membrane-bound acyltransferase family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.984	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0006996	0.989	organelle organization
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0050767	0.978	regulation of neurogenesis
GO:0050769	0.974	positive regulation of neurogenesis
GO:0007275	0.888	multicellular organism development
GO:0048513	0.837	animal organ development
GO:0048869	0.836	cellular developmental process
GO:0007399	0.836	nervous system development
GO:0007420	0.820	brain development
GO:0022008	0.793	neurogenesis
GO:0120036	0.770	plasma membrane bounded cell projection organization
GO:0044237	0.745	cellular metabolic process
GO:0045685	0.735	regulation of glial cell differentiation
GO:0048699	0.713	generation of neurons
GO:0048713	0.687	regulation of oligodendrocyte differentiation
GO:0032200	0.661	telomere organization
GO:0014013	0.639	regulation of gliogenesis
GO:0071704	0.628	organic substance metabolic process
GO:0010975	0.612	regulation of neuron projection development
GO:0031323	0.544	regulation of cellular metabolic process
GO:0060255	0.541	regulation of macromolecule metabolic process
GO:0051171	0.541	regulation of nitrogen compound metabolic process
GO:0048583	0.540	regulation of response to stimulus
GO:0080090	0.540	regulation of primary metabolic process
GO:0048714	0.529	positive regulation of oligodendrocyte differentiation
GO:0006725	0.519	cellular aromatic compound metabolic process
GO:0044238	0.473	primary metabolic process
GO:1901360	0.417	organic cyclic compound metabolic process
GO:0048666	0.366	neuron development
GO:0051130	0.349	positive regulation of cellular component organization
GO:0022607	0.347	cellular component assembly
GO:0046483	0.307	heterocycle metabolic process
GO:0043170	0.305	macromolecule metabolic process
GO:0044260	0.304	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	0.998	centrosome
GO:0043227	0.950	membrane-bounded organelle
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0005634	0.867	nucleus
GO:0005737	0.743	cytoplasm
GO:0012505	0.538	endomembrane system
GO:0005829	0.478	cytosol
GO:0032991	0.378	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]