StarFunc result for job id Q70Z35

User Input

>input (1606 residues)
MSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASK
VDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLIL
KELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE
GSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL
NSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSIESAQEDLQKSHSKPPGDEA
GDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI
EPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHLCQRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGV
QLDSRKHNSHDKENKSSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDL
ETQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSEGIIPTDSDNEKGER
NSKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKYLTPGRGLQEF
QQEMEPKLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEEVKCRLLLALLEYSDSETQ
LRRDMVFCQTLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHF
QSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVY
FYIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEK
VKQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRTAACAN
TACSASGVGLLSVSSELCNRLGACHIIMCSSGVHRCTLSVTLEQAIILARSHGLPPRYIM
QATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R6J2	0.805	0.798	0.000	1622	0.555	0.550	F1R6J2.pdb.gz	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
2	AFDB:Q70Z35	1.000	1.000	0.000	1606	1.000	1.000	Q70Z35.pdb.gz	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
3	AFDB:Q8TCU6	0.790	0.767	0.000	1659	0.585	0.566	Q8TCU6.pdb.gz	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
4	PDB:6pcvA	0.454	0.955	6.351E-67	754	0.276	0.588	6pcvA.pdb.gz
5	PDB:7rx9A	0.119	0.437	6.790E-43	432	0.200	0.745	7rx9A.pdb.gz
6	AFDB:A0A024RDM6	0.190	0.428	1.046E-22	652	0.082	0.202	A0A024RDM6.pdb.gz	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
7	AFDB:Q9NR80	0.178	0.368	1.336E-22	690	0.079	0.184	Q9NR80.pdb.gz	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
8	AFDB:A0A2R8QCF3	0.170	0.426	1.850E-22	550	0.078	0.227	A0A2R8QCF3.pdb.gz
9	AFDB:A0A0A6YYF8	0.164	0.394	4.532E-22	564	0.079	0.225	A0A0A6YYF8.pdb.gz	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
10	PDB:4mt6A	0.163	0.511	3.960E-21	389	0.074	0.306	4mt6A.pdb.gz
11	AFDB:J3KQJ8	0.161	0.413	8.121E-19	550	0.077	0.224	J3KQJ8.pdb.gz	J3KQJ8_HUMAN Spermatogenesis associated 13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
12	AFDB:A0A5F9ZI31	0.146	0.453	1.516E-15	451	0.065	0.231	A0A5F9ZI31.pdb.gz	A0A5F9ZI31_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
13	AFDB:Q54DW7	0.189	0.297	2.187E-15	986	0.059	0.095	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
14	PDB:7pe9I	0.070	0.296	7.457E-13	317	0.059	0.297	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
15	PDB:4gouA	0.103	0.305	4.984E-6	507	0.035	0.110	4gouA.pdb.gz
16	PDB:6u3eA	0.067	0.217	2.148E-3	397	0.036	0.146	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
17	PDB:6bbpA	0.066	0.168	4.292E-3	520	0.038	0.117	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:2byvE	0.061	0.103	1.398E-2	922	0.044	0.077	2byvE.pdb.gz
19	PDB:6t36A	0.051	0.748	1.398E-2	93	0.012	0.204	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
20	PDB:4f7zA	0.062	0.101	1.713E-2	946	0.032	0.054	4f7zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GLR6	0.0	1845	1646	0.587	0.572	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
2	D3ZS72	0.0	1797	1635	0.577	0.567	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
3	F1R6J2	0.0	1764	1622	0.557	0.552	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
4	Q3LAC4	0.0	3170	1598	0.932	0.937	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
5	Q69ZK0	0.0	1855	1650	0.585	0.570	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
6	Q70Z35	0.0	3358	1606	1.000	1.000	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
7	Q8TCU6	0.0	1865	1659	0.585	0.566	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
8	Q9NR80	9.25e-61	224	690	0.087	0.203	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
9	F1Q628	2.56e-57	210	514	0.084	0.263	F1Q628_DANRE Rho guanine nucleotide exchange factor 9 OS=Danio rerio OX=7955 GN=arhgef9 PE=4 SV=1
10	A0A1B0GVC4	2.98e-56	205	454	0.082	0.289	A0A1B0GVC4_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
11	Q9QX73	5.31e-56	205	493	0.083	0.270	ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus OX=10116 GN=Arhgef9 PE=1 SV=1
12	A0A5F9ZGZ3	6.19e-56	205	489	0.082	0.268	A0A5F9ZGZ3_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
13	B1AMR3	6.97e-56	205	495	0.082	0.265	B1AMR3_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
14	A0A1B0GWI5	7.28e-56	206	529	0.082	0.248	A0A1B0GWI5_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
15	Q3UTH8	7.56e-56	206	516	0.082	0.254	ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus OX=10090 GN=Arhgef9 PE=1 SV=1
16	A0A1B0GV84	9.27e-56	205	506	0.082	0.259	A0A1B0GV84_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
17	O43307	1.01e-55	205	516	0.082	0.254	ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=3
18	A0A5F9ZHY9	1.25e-55	205	523	0.082	0.250	A0A5F9ZHY9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
19	A0A0A6YYF8	3.58e-55	205	564	0.082	0.232	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
20	A0A024RDM6	4.81e-55	206	652	0.084	0.207	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	3.3e-37	137.7	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF16702 DUF5063	59	15.5	Domain of unknown function (DUF5063)
3	PF00595 PDZ	2.4e-06	39.1	PDZ domain
4	PF13180 PDZ_2	1.3e+02	14.4	PDZ domain
5	PF17820 PDZ_6	1.1e-09	49.4	PDZ domain
6	PF02163 Peptidase_M50	0.077	23.8	Peptidase family M50
7	PF00169 PH	0.0082	28.0	PH domain
8	PF00621 RhoGEF	9.2e-43	158.1	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288368

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361021	0.982	Phosphatase and tensin homolog
2	9606.ENSP00000348461	0.964	Ras-related C3 botulinum toxin substrate 1
3	9606.ENSP00000361894	0.700	Glycine N-methyltransferase
4	9606.ENSP00000340648	0.673	E3 ubiquitin-protein ligase HUWE1
5	9606.ENSP00000383118	0.671	Cell division control protein 42 homolog
6	9606.ENSP00000481878	0.671	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
7	9606.ENSP00000358548	0.668	GTPase NRas
8	9606.ENSP00000407586	0.644	GTPase HRas
9	9606.ENSP00000249071	0.627	Ras-related C3 botulinum toxin substrate 2
10	9606.ENSP00000354558	0.607	Serine/threonine-protein kinase mTOR
11	9606.ENSP00000326031	0.585	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
12	9606.ENSP00000451828	0.578	RAC-alpha serine/threonine-protein kinase
13	9606.ENSP00000250559	0.562	Ras-related protein Rap-1b
14	9606.ENSP00000358723	0.562	Ras-related protein Rap-1A
15	9606.ENSP00000400175	0.557	Transforming protein RhoA
16	9606.ENSP00000334448	0.547	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
17	9606.ENSP00000337261	0.539	Rho guanine nucleotide exchange factor 1
18	9606.ENSP00000297770	0.536	Carboxypeptidase A6
19	9606.ENSP00000256078	0.530	GTPase KRas
20	9606.ENSP00000304283	0.528	Ras-related C3 botulinum toxin substrate 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	0.999	GTPase activator activity
GO:0005085	0.999	guanyl-nucleotide exchange factor activity
GO:0005515	0.995	protein binding
GO:0019899	0.715	enzyme binding
GO:0005543	0.465	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0051716	0.984	cellular response to stimulus
GO:0007154	0.981	cell communication
GO:0023052	0.977	signaling
GO:0007165	0.967	signal transduction
GO:0048583	0.943	regulation of response to stimulus
GO:0009966	0.907	regulation of signal transduction
GO:1902531	0.830	regulation of intracellular signal transduction
GO:0051056	0.778	regulation of small GTPase mediated signal transduction
GO:0071840	0.685	cellular component organization or biogenesis
GO:0016043	0.680	cellular component organization
GO:0008152	0.461	metabolic process
GO:0048518	0.436	positive regulation of biological process
GO:0035556	0.404	intracellular signal transduction
GO:0032501	0.370	multicellular organismal process
GO:0048856	0.350	anatomical structure development
GO:0048522	0.329	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.995	plasma membrane
GO:0043226	0.743	organelle
GO:0043229	0.654	intracellular organelle
GO:0043227	0.549	membrane-bounded organelle
GO:0043231	0.432	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]