StarFunc result for job id Q70Z44

User Input

>input (454 residues)
MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS
VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS
DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS
FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS
GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM
QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP
TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE
LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70Z44	1.000	1.000	1.087E-81	454	1.000	1.000	Q70Z44.pdb.gz	5HT3D_HUMAN 5-hydroxytryptamine receptor 3D OS=Homo sapiens OX=9606 GN=HTR3D PE=1 SV=3
2	AFDB:A5X5Y0	0.677	0.675	9.534E-47	456	0.595	0.592	A5X5Y0.pdb.gz	5HT3E_HUMAN 5-hydroxytryptamine receptor 3E OS=Homo sapiens OX=9606 GN=HTR3E PE=1 SV=1
3	AFDB:Q8WXA8	0.665	0.674	2.668E-42	447	0.562	0.570	Q8WXA8.pdb.gz	5HT3C_HUMAN 5-hydroxytryptamine receptor 3C OS=Homo sapiens OX=9606 GN=HTR3C PE=1 SV=2
4	AFDB:P23979	0.628	0.591	2.019E-28	487	0.284	0.265	P23979.pdb.gz	5HT3A_MOUSE 5-hydroxytryptamine receptor 3A OS=Mus musculus OX=10090 GN=Htr3a PE=1 SV=2
5	AFDB:O70212	0.630	0.589	6.973E-28	490	0.273	0.253	O70212.pdb.gz	5HT3A_CAVPO 5-hydroxytryptamine receptor 3A OS=Cavia porcellus OX=10141 GN=HTR3A PE=2 SV=1
6	AFDB:P46098	0.612	0.585	1.017E-27	478	0.267	0.253	P46098.pdb.gz	5HT3A_HUMAN 5-hydroxytryptamine receptor 3A OS=Homo sapiens OX=9606 GN=HTR3A PE=1 SV=1
7	AFDB:Q9JHJ5	0.547	0.564	3.530E-23	437	0.214	0.222	Q9JHJ5.pdb.gz	5HT3B_MOUSE 5-hydroxytryptamine receptor 3B OS=Mus musculus OX=10090 GN=Htr3b PE=2 SV=1
8	AFDB:Q9GZZ6	0.604	0.609	7.506E-23	450	0.220	0.222	Q9GZZ6.pdb.gz	ACH10_HUMAN Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1
9	AFDB:P36544	0.604	0.553	1.287E-22	502	0.205	0.185	P36544.pdb.gz	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
10	AFDB:Q9U298	0.631	0.608	1.358E-22	474	0.172	0.165	Q9U298.pdb.gz	ACH8_CAEEL Neuronal acetylcholine receptor subunit eat-2 OS=Caenorhabditis elegans OX=6239 GN=eat-2 PE=2 SV=1
11	PDB:6i53A	0.444	0.551	1.516E-13	349	0.084	0.109	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:4hfcA	0.411	0.555	1.782E-13	311	0.073	0.106	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
13	PDB:6i53B	0.445	0.566	5.527E-13	338	0.086	0.115	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:4aq5E	0.407	0.479	1.937E-11	370	0.119	0.146	4aq5E.pdb.gz
15	PDB:2w8gC	0.339	0.652	1.087E-10	217	0.064	0.134	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
16	PDB:7kuyE	0.386	0.489	1.147E-10	338	0.073	0.098	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
17	PDB:7l6qA	0.406	0.554	1.672E-10	311	0.081	0.119	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
18	PDB:4afhA	0.307	0.597	6.529E-9	213	0.059	0.127	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
19	PDB:6zgdA	0.354	0.513	2.839E-7	288	0.064	0.101	6zgdA.pdb.gz
20	PDB:4xo4A	0.117	0.073	7.133E-3	870	0.044	0.023	4xo4A.pdb.gz	Crystal Structure of E. coli Aminopeptidase N in complex with L-Methionine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q70Z44	0.0	940	454	1.000	1.000	5HT3D_HUMAN 5-hydroxytryptamine receptor 3D OS=Homo sapiens OX=9606 GN=HTR3D PE=1 SV=3
2	A5X5Y0	6.08e-180	512	456	0.610	0.607	5HT3E_HUMAN 5-hydroxytryptamine receptor 3E OS=Homo sapiens OX=9606 GN=HTR3E PE=1 SV=1
3	Q8WXA8	3.66e-154	446	447	0.559	0.568	5HT3C_HUMAN 5-hydroxytryptamine receptor 3C OS=Homo sapiens OX=9606 GN=HTR3C PE=1 SV=2
4	P46098	1.18e-46	169	478	0.295	0.280	5HT3A_HUMAN 5-hydroxytryptamine receptor 3A OS=Homo sapiens OX=9606 GN=HTR3A PE=1 SV=1
5	P35563	5.78e-45	165	483	0.289	0.271	5HT3A_RAT 5-hydroxytryptamine receptor 3A OS=Rattus norvegicus OX=10116 GN=Htr3a PE=1 SV=2
6	P23979	1.60e-43	161	487	0.295	0.275	5HT3A_MOUSE 5-hydroxytryptamine receptor 3A OS=Mus musculus OX=10090 GN=Htr3a PE=1 SV=2
7	O70212	6.64e-42	157	490	0.280	0.259	5HT3A_CAVPO 5-hydroxytryptamine receptor 3A OS=Cavia porcellus OX=10141 GN=HTR3A PE=2 SV=1
8	Q9JHJ5	1.44e-21	99.0	437	0.231	0.240	5HT3B_MOUSE 5-hydroxytryptamine receptor 3B OS=Mus musculus OX=10090 GN=Htr3b PE=2 SV=1
9	Q9JJ16	3.68e-21	97.8	437	0.227	0.236	5HT3B_RAT 5-hydroxytryptamine receptor 3B OS=Rattus norvegicus OX=10116 GN=Htr3b PE=1 SV=1
10	Q9GZZ6	1.39e-20	95.9	450	0.227	0.229	ACH10_HUMAN Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1
11	Q8BMN3	2.49e-20	95.5	464	0.231	0.226	ACHB3_MOUSE Neuronal acetylcholine receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Chrnb3 PE=2 SV=1
12	O95264	1.25e-19	93.2	441	0.222	0.229	5HT3B_HUMAN 5-hydroxytryptamine receptor 3B OS=Homo sapiens OX=9606 GN=HTR3B PE=1 SV=1
13	P12391	3.28e-19	92.0	464	0.233	0.228	ACHB3_RAT Neuronal acetylcholine receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Chrnb3 PE=2 SV=1
14	Q05901	1.39e-18	90.1	458	0.209	0.207	ACHB3_HUMAN Neuronal acetylcholine receptor subunit beta-3 OS=Homo sapiens OX=9606 GN=CHRNB3 PE=1 SV=2
15	Q9I8C7	1.12e-17	87.4	452	0.211	0.212	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
16	Q9JLB5	3.80e-17	85.5	447	0.220	0.224	ACH10_RAT Neuronal acetylcholine receptor subunit alpha-10 OS=Rattus norvegicus OX=10116 GN=Chrna10 PE=1 SV=1
17	P02711	5.60e-16	82.0	461	0.194	0.191	ACHA_TORMA Acetylcholine receptor subunit alpha OS=Torpedo marmorata OX=7788 GN=CHRNA1 PE=1 SV=1
18	E1JJR2	2.92e-15	80.5	564	0.165	0.133	E1JJR2_DROME Nicotinic acetylcholine receptor alpha7, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=1
19	Q9VWI9	2.97e-15	80.1	560	0.165	0.134	Q9VWI9_DROME Nicotinic acetylcholine receptor alpha7, isoform A OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=4
20	P02710	5.00e-15	79.3	461	0.192	0.189	ACHA_TETCF Acetylcholine receptor subunit alpha OS=Tetronarce californica OX=7787 GN=CHRNA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	0.0028	28.6	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	1.2e-06	40.4	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347754	0.888	5-hydroxytryptamine receptor 3A
2	9606.ENSP00000260191	0.871	5-hydroxytryptamine receptor 3B
3	9606.ENSP00000322617	0.810	5-hydroxytryptamine receptor 3C
4	9606.ENSP00000308820	0.679	Protein RIC-3
5	9606.ENSP00000406050	0.626	5-hydroxytryptamine receptor 3E
6	9606.ENSP00000287907	0.560	5-hydroxytryptamine receptor 5A
7	9606.ENSP00000337949	0.504	5-hydroxytryptamine receptor 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0099589	1.000	serotonin receptor activity
GO:0099094	1.000	ligand-gated monoatomic cation channel activity
GO:0022824	1.000	transmitter-gated monoatomic ion channel activity
GO:0098960	0.974	postsynaptic neurotransmitter receptor activity
GO:1904315	0.596	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0005231	0.511	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0022848	0.372	acetylcholine-gated monoatomic cation-selective channel activity
GO:0022850	0.317	serotonin-gated monoatomic cation-selective channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050789	0.995	regulation of biological process
GO:0098662	0.987	inorganic cation transmembrane transport
GO:0007210	0.985	serotonin receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034702	0.996	ion channel complex
GO:0098802	0.995	plasma membrane signaling receptor complex
GO:0034703	0.970	cation channel complex
GO:0098878	0.970	neurotransmitter receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]