StarFunc result for job id Q711Q0

User Input

>input (1435 residues)
MMQGNKKCTDAFSDSSSIGSVLDDADREVSSLTDRAFRSLCISEDTSFHDSYLAVSPDIT
RQVFGTFHQRTVGHTQRKSGIWSQLPSQGTEHSGWAATFQQLPKYVQGEEKYPKTSPPPT
PVQRRLEVPVSGLRSSNKPVSKVSTLIKSFDRTESQRCESRPTASKPPALKNPPKFAPLP
ENSVNFCFDSAFLTVRRVPAEVSNTHQNSYQPGRKHGEQESSKNPEMACHGSSSFLPAAN
DTATLCESKFPSPHHKPVTGEPGRGKGTFLHSENSAFESWNAHQPKLLERKDTAGTVPES
KAPKHYGDTTLLREPCPPERTVSPCQVQASCSQEENRLAAGALSTSIPWGCRDPGAQVFA
VEGKAPSSQPDSQEKPAQPPWRKPKTGKKGKESLQDTLEEKTQTNQRGPPLYTKHNPQEQ
FSENNALDLPVEPNEHYDPPFNISKLLTPIIPSKHALDSADSQPAERTPSPPGQLNGYQE
KEPSECQSRDSYKSKAPSLLFNLKDVRKRVKSTYSSSPLLKVLDEKTRGKVDGKQEPVSN
GVILPNGLEESPPNELSKERPADDPTASHINPQKDPTADPSEPSADSYLTLSTAPTIAKA
PFYVNGEAAERSSYENKEVEGELEMGPAGSSWCPDSREHRPRKHLSLRLCNRDPEPGGAT
EKMKTHQLENGLSRSVSQETEPEREAGLQNTHLNQKFFPGPLSPEEEDVFYSDSQSDFMP
SLKGKAKFSTSSSDQSFASFDDQQKMWFTENQREDRRKDVSAGDSQKDEKENVMRKDELQ
YCALSNGHACLENRSQGEALQRERESVSGGRTRKASAEEANFRGSWIGENKGTTFSQAKD
LTPSPSSASNRHMLFTIKDNTLRATPVIKPIMLPLLRTMSLEDSLSSGHKEEELPRPEWG
EDPGFCAPENQDILGTSTPTNTRGTRVKCMANEVMEDPGQGSSMARMEASQPAPKGNFPS
MPLVGEGDRVKAPPDAAPGLVASNCKSGSADSGKLAAPWHIPTIALPEGDIEDQPPPWQP
ENCWEEQTPGFKSHFLSTPRAGPPGRRLVPSERANSPNPGSPGESSACSPAASNIWEESS
QAPGGPELLPEEPNQASPWASSSPARVTRREDLTHALVWEGGSDPLLELSAEDLRTLSPR
GSLLDVATSPAGTSGRLELPAQLERTASKPPAVPPKTEKALRRAKKLASKRRKTDQAQEK
HGESQEGKPCPEDLEQTQQRPLCPRERPRHNFPVVRSLPPPVHRHSVSGFSEPVGRRPGG
PQSLTPLPAYPATQKVLQDPQSGEYFVFDLPLQVKIKTFYDPETGKYVKVSIPSSEGASP
EPPPPDALAAPYVLYPGFQPVPVTALMPLRCSSQLSAPTFLRQGPRASAARARTQSVHES
GLQLDPGPHGDCTPHSAGQRPHGPPQSPGEEGVEAPGLGIISTDDLEDFATEGIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z1D3	0.162	0.163	0.000	1412	0.656	0.666	D3Z1D3.pdb.gz	CEFIP_MOUSE Cardiac-enriched FHL2-interacting protein OS=Mus musculus OX=10090 GN=CEFIP PE=1 SV=1
2	AFDB:M0RD54	0.167	0.169	0.000	1422	0.668	0.674	M0RD54.pdb.gz	CEFIP_RAT Cardiac-enriched FHL2-interacting protein OS=Rattus norvegicus OX=10116 GN=CEFIP PE=3 SV=2
3	AFDB:Q711Q0	0.999	0.999	0.000	1435	1.000	1.000	Q711Q0.pdb.gz	CEFIP_HUMAN Cardiac-enriched FHL2-interacting protein OS=Homo sapiens OX=9606 GN=CEFIP PE=1 SV=2
4	AFDB:E7EW31	0.041	0.051	7.292E-5	1015	0.158	0.224	E7EW31.pdb.gz	PROB1_HUMAN Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2
5	AFDB:E9PYH6	0.032	0.027	2.501E-2	1716	0.151	0.126	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
6	AFDB:A7KAX9	0.033	0.026	3.459E-2	2087	0.156	0.107	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
7	AFDB:O60885	0.038	0.039	3.691E-2	1362	0.108	0.114	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
8	AFDB:P20482	0.032	0.035	3.938E-2	1383	0.132	0.137	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
9	AFDB:Q7Z591	0.036	0.036	4.784E-2	1439	0.165	0.165	Q7Z591.pdb.gz	AKNA_HUMAN Microtubule organization protein AKNA OS=Homo sapiens OX=9606 GN=AKNA PE=1 SV=2
10	AFDB:D3ZGX1	0.039	0.038	5.812E-2	1517	0.144	0.136	D3ZGX1.pdb.gz	NEXMI_RAT Neurite extension and migration factor OS=Rattus norvegicus OX=10116 GN=Nexmif PE=1 SV=1
11	PDB:4v6wAI	0.024	0.121	2.040	207	0.007	0.048	4v6wAI.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:7f5yB	0.022	0.161	2.040	120	0.008	0.092	7f5yB.pdb.gz
13	PDB:7vbaN	0.025	0.167	2.040	151	0.010	0.093	7vbaN.pdb.gz	Structure of the human RNA polymerase I elongation complex.
14	PDB:3j6bX	0.021	0.241	2.322	64	0.010	0.219	3j6bX.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
15	PDB:7abzX	0.021	0.188	2.644	77	0.003	0.065	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
16	PDB:6edtJ	0.020	0.176	3.212	109	0.010	0.128	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
17	PDB:6nb7B	0.019	0.025	3.212	1032	0.006	0.009	6nb7B.pdb.gz
18	PDB:2wu9A	0.017	0.055	3.657	403	0.003	0.012	2wu9A.pdb.gz
19	PDB:7p5xAJ	0.017	0.231	3.902	89	0.006	0.101	7p5xAJ.pdb.gz	Transcriptional control of mycobacterial DNA damage response by sigma adaptation.
20	PDB:5y58B	0.026	0.053	4.163	568	0.006	0.014	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z1D3	0.0	1718	1412	0.659	0.669	CEFIP_MOUSE Cardiac-enriched FHL2-interacting protein OS=Mus musculus OX=10090 GN=CEFIP PE=1 SV=1
2	M0RD54	0.0	1726	1422	0.668	0.674	CEFIP_RAT Cardiac-enriched FHL2-interacting protein OS=Rattus norvegicus OX=10116 GN=CEFIP PE=3 SV=2
3	Q711Q0	0.0	2925	1435	1.000	1.000	CEFIP_HUMAN Cardiac-enriched FHL2-interacting protein OS=Homo sapiens OX=9606 GN=CEFIP PE=1 SV=2
4	E7EW31	2.49e-04	48.1	1015	0.012	0.017	PROB1_HUMAN Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15232 DUF4585	3.4e-24	96.0	Domain of unknown function (DUF4585)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457205	0.740	UPF0583 protein C15orf59
2	9606.ENSP00000381932	0.683	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
3	9606.ENSP00000469863	0.683	Dual specificity tyrosine-phosphorylation-regulated kinase 1B
4	9606.ENSP00000303423	0.652	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
5	9606.ENSP00000423550	0.648	Involved in repair of DNA damage following UV irradiation, acting either in the absence of ERCC6 or synergistically with ERCC6. Involved in the regulation of gene expression. In the absence of ERCC6, induces the expression of genes characteristic of interferon-like antiviral responses. This response is almost completely suppressed in the presence of ERCC6. In the presence of ERCC6, regulates the expression of genes involved in metabolism regulation, including IGFBP5 and IGFBP7. In vitro binds to PGBD3-related transposable elements, called MER85s
6	9606.ENSP00000348089	0.640	DNA excision repair protein ERCC-6
7	9606.ENSP00000483236	0.631	DDB1- and CUL4-associated factor 7
8	9606.ENSP00000334163	0.562	Spindlin-4
9	9606.ENSP00000316012	0.529	Sperm associated antigen 11A
10	9606.ENSP00000386665	0.529	Four and a half LIM domains protein 2
11	9606.ENSP00000265038	0.527	DNA excision repair protein ERCC-8
12	9606.ENSP00000378312	0.506	EF-hand calcium-binding domain-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.932	positive regulation of biological process
GO:0048522	0.924	positive regulation of cellular process
GO:0048584	0.916	positive regulation of response to stimulus
GO:0106056	0.737	regulation of calcineurin-mediated signaling
GO:0070884	0.642	regulation of calcineurin-NFAT signaling cascade
GO:1902533	0.596	positive regulation of intracellular signal transduction
GO:0009987	0.557	cellular process
GO:0050850	0.522	positive regulation of calcium-mediated signaling
GO:0032502	0.309	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030018	0.996	Z disc
GO:0005654	0.956	nucleoplasm
GO:0032991	0.514	protein-containing complex
GO:0005856	0.344	cytoskeleton
GO:0005829	0.308	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]