StarFunc result for job id Q712K3

User Input

>input (238 residues)
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKA
HIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDG
VKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q712K3	1.000	1.000	2.399E-47	238	1.000	1.000	Q712K3.pdb.gz	UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1
2	AFDB:A0A024R1Z1	0.802	0.809	5.611E-36	236	0.803	0.809	A0A024R1Z1.pdb.gz
3	AFDB:P62253	0.660	0.915	1.992E-22	170	0.353	0.494	P62253.pdb.gz	UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens OX=9606 GN=UBE2G1 PE=1 SV=3
4	AFDB:Q42541	0.669	0.952	1.019E-21	166	0.336	0.482	Q42541.pdb.gz	UBC13_ARATH Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana OX=3702 GN=UBC13 PE=2 SV=1
5	AFDB:Q9N9Z5	0.682	0.809	1.179E-20	200	0.324	0.385	Q9N9Z5.pdb.gz	Q9N9Z5_DROME Ubiquitin conjugating enzyme OS=Drosophila melanogaster OX=7227 GN=Ubc7 PE=2 SV=1
6	AFDB:F4IWU7	0.631	0.744	1.829E-20	201	0.349	0.413	F4IWU7.pdb.gz	F4IWU7_ARATH Ubiquitin-conjugating enzyme 14 OS=Arabidopsis thaliana OX=3702 GN=UBC14 PE=1 SV=1
7	AFDB:P60604	0.654	0.935	1.947E-20	165	0.324	0.467	P60604.pdb.gz	UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens OX=9606 GN=UBE2G2 PE=1 SV=1
8	AFDB:O00102	0.643	0.914	2.116E-19	166	0.307	0.440	O00102.pdb.gz	UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc7 PE=1 SV=2
9	AFDB:Q02159	0.630	0.893	1.082E-18	165	0.303	0.436	Q02159.pdb.gz	UBC7_YEAST Ubiquitin-conjugating enzyme E2 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC7 PE=1 SV=1
10	AFDB:P14682	0.715	0.585	1.152E-18	295	0.336	0.271	P14682.pdb.gz	UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC34 PE=1 SV=1
11	PDB:6d68A	0.604	0.891	1.731E-18	159	0.336	0.503	6d68A.pdb.gz
12	PDB:2cyxA	0.640	0.890	7.336E-18	169	0.328	0.462	2cyxA.pdb.gz
13	PDB:6op8A	0.645	0.906	3.524E-17	167	0.307	0.437	6op8A.pdb.gz
14	PDB:2uczA	0.616	0.877	8.133E-16	164	0.303	0.439	2uczA.pdb.gz
15	PDB:6cyrA	0.595	0.912	1.431E-15	153	0.256	0.399	6cyrA.pdb.gz
16	PDB:6zhuF	0.622	0.819	2.364E-15	178	0.282	0.376	6zhuF.pdb.gz	ATP induced conformational changes facilitate E1-E2 disulfide bridging in the ubiquitin system
17	PDB:2aakA	0.600	0.941	3.446E-15	150	0.244	0.387	2aakA.pdb.gz
18	PDB:4m1nC	0.592	0.865	2.128E-14	160	0.218	0.325	4m1nC.pdb.gz
19	PDB:3rczB	0.591	0.892	3.744E-14	155	0.239	0.368	3rczB.pdb.gz
20	PDB:2pe6A	0.569	0.826	9.600E-14	161	0.231	0.342	2pe6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q712K3	5.59e-179	492	238	1.000	1.000	UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1
2	P49427	2.86e-141	397	236	0.811	0.818	UB2R1_HUMAN Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens OX=9606 GN=CDC34 PE=1 SV=2
3	D4A453	1.48e-140	395	235	0.811	0.821	D4A453_RAT Cell division cycle 34, ubiqiutin conjugating enzyme OS=Rattus norvegicus OX=10116 GN=Cdc34 PE=3 SV=2
4	Q8CFI2	1.48e-140	395	235	0.811	0.821	UB2R1_MOUSE Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus OX=10090 GN=Cdc34 PE=1 SV=1
5	A0A8I6AJQ8	1.16e-100	292	190	0.647	0.811	A0A8I6AJQ8_RAT Cell division cycle 34, ubiqiutin conjugating enzyme OS=Rattus norvegicus OX=10116 GN=Cdc34 PE=3 SV=1
6	P62253	1.68e-57	182	170	0.378	0.529	UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens OX=9606 GN=UBE2G1 PE=1 SV=3
7	P62254	1.68e-57	182	170	0.378	0.529	UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus OX=10090 GN=Ube2g1 PE=1 SV=3
8	P62255	1.68e-57	182	170	0.378	0.529	UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus OX=10116 GN=Ube2g1 PE=2 SV=3
9	Q42541	1.27e-51	167	166	0.324	0.464	UBC13_ARATH Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana OX=3702 GN=UBC13 PE=2 SV=1
10	Q9VXE8	9.09e-49	159	167	0.336	0.479	Q9VXE8_DROME RE34144p OS=Drosophila melanogaster OX=7227 GN=Ubc7 PE=1 SV=1
11	Q9N9Z5	4.62e-47	156	200	0.315	0.375	Q9N9Z5_DROME Ubiquitin conjugating enzyme OS=Drosophila melanogaster OX=7227 GN=Ubc7 PE=2 SV=1
12	F4IWU7	7.83e-47	155	201	0.332	0.393	F4IWU7_ARATH Ubiquitin-conjugating enzyme 14 OS=Arabidopsis thaliana OX=3702 GN=UBC14 PE=1 SV=1
13	P60604	5.81e-46	152	165	0.340	0.491	UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens OX=9606 GN=UBE2G2 PE=1 SV=1
14	P60605	5.81e-46	152	165	0.340	0.491	UB2G2_MOUSE Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus OX=10090 GN=Ube2g2 PE=1 SV=1
15	P14682	1.02e-43	150	295	0.357	0.288	UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC34 PE=1 SV=1
16	O00102	1.19e-43	146	166	0.311	0.446	UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc7 PE=1 SV=2
17	Q02159	5.62e-42	142	165	0.298	0.430	UBC7_YEAST Ubiquitin-conjugating enzyme E2 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC7 PE=1 SV=1
18	Q382B7	1.44e-38	136	247	0.303	0.291	Q382B7_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5790 PE=3 SV=1
19	P52478	3.30e-31	115	192	0.261	0.323	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
20	P63146	3.95e-31	114	152	0.256	0.401	UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00179 UQ_con	6.5e-41	150.7	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9986.ENSOCUP00000024929

Rank	PPI partner	STRING score	Description
1	9986.ENSOCUP00000002198	0.971	Cullin 1
2	9986.ENSOCUP00000007237	0.967	Catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation through the ubiquitin-proteasome system. Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a ubiquitin-E1 thioester and free AMP . Essential for the formation of radiation-induced foci, timely DNA repair and for response to replication stress. Promotes the recruitment of TP53BP1 and BRCA1 at DNA damage sites (By similarity)
3	9986.ENSOCUP00000020468	0.964	Uncharacterized protein
4	9986.ENSOCUP00000001111	0.957	Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair
5	9986.ENSOCUP00000007292	0.935	F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase
6	9986.ENSOCUP00000003131	0.905	Ubiquitin
7	9986.ENSOCUP00000011048	0.902	Ubiquitin-like modifier activating enzyme 6
8	9986.ENSOCUP00000019232	0.897	Cell division cycle 34
9	9986.ENSOCUP00000007901	0.886	Uncharacterized protein
10	9986.ENSOCUP00000005704	0.884	Ubiquitin-like modifier activating enzyme 7
11	9986.ENSOCUP00000009185	0.838	Cullin 3
12	9986.ENSOCUP00000016545	0.807	Ubiquitin-conjugating enzyme E2 variant 1
13	9986.ENSOCUP00000007065	0.774	Ubiquitin-like modifier activating enzyme 3
14	9986.ENSOCUP00000013190	0.764	Beta-transducin repeat containing E3 ubiquitin protein ligase
15	9986.ENSOCUP00000003216	0.737	Ubiquitin-conjugating enzyme E2Q family member 1
16	9986.ENSOCUP00000013006	0.736	Ankyrin repeat and zinc finger domain containing 1
17	9986.ENSOCUP00000012456	0.734	E3 ubiquitin-protein ligase
18	9986.ENSOCUP00000013332	0.723	CDK2-associated, cullin domain 1
19	9986.ENSOCUP00000018949	0.723	Coiled-coil domain containing 192
20	9986.ENSOCUP00000022667	0.719	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061631	1.000	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032446	0.996	protein modification by small protein conjugation
GO:0000209	0.986	protein polyubiquitination
GO:0070936	0.970	protein K48-linked ubiquitination
GO:0009987	0.941	cellular process
GO:0044237	0.911	cellular metabolic process
GO:0044260	0.854	cellular macromolecule metabolic process
GO:0065007	0.825	biological regulation
GO:0006513	0.678	protein monoubiquitination
GO:0050794	0.599	regulation of cellular process
GO:0050896	0.563	response to stimulus
GO:0051603	0.510	proteolysis involved in protein catabolic process
GO:0019941	0.504	modification-dependent protein catabolic process
GO:0006511	0.459	ubiquitin-dependent protein catabolic process
GO:0048518	0.373	positive regulation of biological process
GO:0048522	0.349	positive regulation of cellular process
GO:0051716	0.330	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005634	0.814	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.2.23	1.000	E2 ubiquitin-conjugating enzyme.

[back to server]