StarFunc result for job id Q717R9

User Input

>input (158 residues)
MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSP
VAPPDGRDETLRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSG
NVSEAPGSGRKKPERPAAISYDHSEEGLMASIEREYCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q717R9	1.000	1.000	2.056E-20	158	1.000	1.000	Q717R9.pdb.gz	CYS1_HUMAN Cystin-1 OS=Homo sapiens OX=9606 GN=CYS1 PE=1 SV=1
2	AFDB:Q382M5	0.179	0.060	3.385	597	0.177	0.047	Q382M5.pdb.gz	Q382M5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4690 PE=4 SV=1
3	AFDB:P87235	0.129	0.039	7.363	686	0.152	0.035	P87235.pdb.gz	RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp42 PE=3 SV=1
4	AFDB:Q8Y125	0.128	0.056	7.958	488	0.146	0.047	Q8Y125.pdb.gz	Q8Y125_RALN1 Type III effector protein popp2 OS=Ralstonia nicotianae (strain GMI1000) OX=267608 GN=popP2 PE=1 SV=2
5	AFDB:Q95XU6	0.128	0.036	7.958	740	0.165	0.035	Q95XU6.pdb.gz	ZC3HE_CAEEL Zinc finger CCCH domain-containing protein 14 OS=Caenorhabditis elegans OX=6239 GN=sut-2 PE=3 SV=2
6	AFDB:Q9M035	0.112	0.054	7.958	427	0.158	0.059	Q9M035.pdb.gz	Q9M035_ARATH ALC-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=ACI1 PE=1 SV=1
7	AFDB:Q57XL0	0.139	0.064	8.601	453	0.196	0.068	Q57XL0.pdb.gz	Q57XL0_TRYB2 DUF4201 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.840 PE=4 SV=1
8	AFDB:P58501	0.159	0.038	9.296	919	0.209	0.036	P58501.pdb.gz	PAXB1_MOUSE PAX3- and PAX7-binding protein 1 OS=Mus musculus OX=10090 GN=Paxbp1 PE=1 SV=3
9	AFDB:Q9SLL2	0.134	0.067	9.296	366	0.171	0.074	Q9SLL2.pdb.gz	BIG1B_ARATH Protein BIG GRAIN 1-like B OS=Arabidopsis thaliana OX=3702 GN=At1g54200 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q717R9	4.82e-105	298	158	1.000	1.000	CYS1_HUMAN Cystin-1 OS=Homo sapiens OX=9606 GN=CYS1 PE=1 SV=1
2	Q8R4T1	3.22e-38	129	145	0.582	0.634	CYS1_MOUSE Cystin-1 OS=Mus musculus OX=10090 GN=Cys1 PE=1 SV=1
3	Q8JZQ9	0.50	32.7	803	0.203	0.040	EIF3B_MOUSE Eukaryotic translation initiation factor 3 subunit B OS=Mus musculus OX=10090 GN=Eif3b PE=1 SV=1
4	P27249	1.2	31.6	890	0.139	0.025	GLND_ECOLI Bifunctional uridylyltransferase/uridylyl-removing enzyme OS=Escherichia coli (strain K12) OX=83333 GN=glnD PE=1 SV=2
5	A8TX70	2.6	30.8	2615	0.234	0.014	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
6	Q6Z0E2	3.7	30.0	989	0.120	0.019	CCC1_ORYSJ Cation-chloride cotransporter 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CCC1 PE=2 SV=1
7	O43613	4.5	29.6	425	0.133	0.049	OX1R_HUMAN Orexin/Hypocretin receptor type 1 OS=Homo sapiens OX=9606 GN=HCRTR1 PE=1 SV=2
8	P16383	5.7	29.6	781	0.114	0.023	GCFC2_HUMAN Intron Large complex component GCFC2 OS=Homo sapiens OX=9606 GN=GCFC2 PE=1 SV=2
9	Q9SK92	7.9	28.9	381	0.127	0.052	ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana OX=3702 GN=ATL15 PE=1 SV=1
10	Q8IK37	8.4	29.3	2241	0.146	0.010	Q8IK37_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1000100 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371234

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338766	0.921	Nephrocystin-3
2	9606.ENSP00000387498	0.763	Galactoside 2-alpha-L-fucosyltransferase 2
3	9606.ENSP00000344942	0.717	Protein unc-119 homolog B
4	9606.ENSP00000218340	0.662	Protein XRP2
5	9606.ENSP00000260746	0.658	ADP-ribosylation factor-like protein 3
6	9606.ENSP00000323580	0.642	Intraflagellar transport protein 88 homolog
7	9606.ENSP00000359976	0.642	Cystathionine gamma-lyase
8	9606.ENSP00000365486	0.642	Beta-defensin 123
9	9606.ENSP00000245457	0.624	Prostaglandin E2 receptor EP2 subtype
10	9606.ENSP00000302846	0.604	Prostaglandin E2 receptor EP4 subtype
11	9606.ENSP00000217386	0.561	Oxytocin-neurophysin 1
12	9606.ENSP00000367398	0.518	Nephrocystin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.986	regulation of cellular process
GO:0032501	0.959	multicellular organismal process
GO:0019222	0.895	regulation of metabolic process
GO:0048518	0.838	positive regulation of biological process
GO:0048522	0.828	positive regulation of cellular process
GO:0048856	0.766	anatomical structure development
GO:0009987	0.731	cellular process
GO:0031323	0.610	regulation of cellular metabolic process
GO:0048513	0.604	animal organ development
GO:0007275	0.521	multicellular organism development
GO:0051171	0.518	regulation of nitrogen compound metabolic process
GO:0080090	0.514	regulation of primary metabolic process
GO:0060255	0.512	regulation of macromolecule metabolic process
GO:0009893	0.502	positive regulation of metabolic process
GO:0065009	0.481	regulation of molecular function
GO:0048731	0.450	system development
GO:0031326	0.442	regulation of cellular biosynthetic process
GO:0031325	0.439	positive regulation of cellular metabolic process
GO:0010604	0.435	positive regulation of macromolecule metabolic process
GO:0001822	0.435	kidney development
GO:0010468	0.426	regulation of gene expression
GO:0019219	0.421	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.419	regulation of macromolecule biosynthetic process
GO:0051173	0.417	positive regulation of nitrogen compound metabolic process
GO:0045935	0.414	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.389	positive regulation of DNA-templated transcription
GO:0044092	0.384	negative regulation of molecular function
GO:0006357	0.383	regulation of transcription by RNA polymerase II
GO:0051090	0.361	regulation of DNA-binding transcription factor activity
GO:0045944	0.351	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005929	0.999	cilium
GO:0043229	0.892	intracellular organelle
GO:0043231	0.782	intracellular membrane-bounded organelle
GO:0043232	0.496	intracellular non-membrane-bounded organelle
GO:0005634	0.463	nucleus
GO:0005815	0.461	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]