StarFunc result for job id Q719H9

User Input

>input (257 residues)
MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLF
DGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPM
LLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVN
AGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELR
RTPRVPSVIRIKQEPLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2U3U043	0.902	0.274	3.333E-49	865	1.000	0.297	A0A2U3U043.pdb.gz	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
2	AFDB:Q8K0E1	0.835	0.764	7.632E-44	283	0.802	0.728	Q8K0E1.pdb.gz	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
3	AFDB:Q5XJ34	0.719	0.719	1.293E-42	257	0.798	0.798	Q5XJ34.pdb.gz	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
4	AFDB:D5SHR0	0.452	0.318	8.370E-30	367	0.482	0.338	D5SHR0.pdb.gz	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
5	AFDB:Q8NC69	0.373	0.402	3.610E-18	237	0.245	0.266	Q8NC69.pdb.gz	KCTD6_HUMAN BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2
6	AFDB:Q9VDH3	0.363	0.407	5.103E-17	228	0.276	0.311	Q9VDH3.pdb.gz	Q9VDH3_DROME GH08630p OS=Drosophila melanogaster OX=7227 GN=Ktl PE=1 SV=1
7	AFDB:Q68DU8	0.415	0.265	6.302E-15	428	0.268	0.161	Q68DU8.pdb.gz	KCD16_HUMAN BTB/POZ domain-containing protein KCTD16 OS=Homo sapiens OX=9606 GN=KCTD16 PE=1 SV=1
8	AFDB:Q50H33	0.402	0.230	1.020E-14	476	0.268	0.145	Q50H33.pdb.gz	KCTD8_MOUSE BTB/POZ domain-containing protein KCTD8 OS=Mus musculus OX=10090 GN=Kctd8 PE=1 SV=1
9	AFDB:A8KBL3	0.364	0.333	2.370E-14	282	0.268	0.245	A8KBL3.pdb.gz
10	AFDB:Q804Q4	0.374	0.337	3.612E-14	288	0.249	0.222	Q804Q4.pdb.gz	Q804Q4_DANRE BTB/POZ domain-containing protein KCTD12 OS=Danio rerio OX=7955 GN=lov PE=2 SV=1
11	PDB:6sgaFS	0.398	0.376	5.261E-11	277	0.195	0.181	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
12	PDB:7w6sB	0.338	0.203	1.379E-6	448	0.109	0.062	7w6sB.pdb.gz
13	PDB:7sizB	0.335	0.263	1.979E-6	334	0.105	0.081	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
14	PDB:2a79B	0.330	0.328	4.329E-6	259	0.109	0.108	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
15	PDB:3lutB	0.321	0.217	4.598E-6	390	0.101	0.067	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
16	PDB:7phhA	0.294	0.194	4.883E-6	396	0.109	0.071	7phhA.pdb.gz
17	PDB:7sszA	0.330	0.240	2.972E-5	362	0.101	0.072	7sszA.pdb.gz
18	PDB:7f3fA	0.329	0.193	3.561E-5	460	0.128	0.072	7f3fA.pdb.gz
19	PDB:7pquA	0.303	0.240	7.333E-5	328	0.105	0.082	7pquA.pdb.gz
20	PDB:6wcqC	0.272	0.479	1.021E-2	130	0.047	0.092	6wcqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2U3U043	0.0	538	865	1.000	0.297	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
2	Q719H9	0.0	532	257	1.000	1.000	KCTD1_HUMAN BTB/POZ domain-containing protein KCTD1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
3	Q8K0E1	6.71e-155	434	283	0.802	0.728	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
4	Q96SI1	1.34e-154	433	283	0.798	0.724	KCD15_HUMAN BTB/POZ domain-containing protein KCTD15 OS=Homo sapiens OX=9606 GN=KCTD15 PE=1 SV=1
5	Q5XJ34	3.99e-153	428	257	0.790	0.790	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
6	Q6DC02	1.25e-152	427	257	0.786	0.786	KCD15_DANRE BTB/POZ domain-containing protein kctd15 OS=Danio rerio OX=7955 GN=kctd15 PE=1 SV=1
7	D5SHR0	4.08e-76	237	367	0.486	0.341	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
8	Q4G0X4	4.91e-26	104	260	0.187	0.185	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
9	Q9VDH3	6.67e-22	92.8	228	0.268	0.303	Q9VDH3_DROME GH08630p OS=Drosophila melanogaster OX=7227 GN=Ktl PE=1 SV=1
10	Q8NC69	2.10e-21	91.7	237	0.191	0.207	KCTD6_HUMAN BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2
11	Q8WVF5	4.38e-20	88.6	259	0.167	0.166	KCTD4_HUMAN BTB/POZ domain-containing protein KCTD4 OS=Homo sapiens OX=9606 GN=KCTD4 PE=1 SV=2
12	Q8N5I3	5.31e-16	77.4	272	0.132	0.125	KCNRG_HUMAN Potassium channel regulatory protein OS=Homo sapiens OX=9606 GN=KCNRG PE=1 SV=1
13	Q561T3	2.25e-15	75.9	271	0.144	0.137	Q561T3_DANRE Potassium channel tetramerisation domain-containing 12.2 OS=Danio rerio OX=7955 GN=ron PE=1 SV=2
14	Q8C7J6	2.91e-14	73.2	292	0.156	0.137	Q8C7J6_MOUSE Potassium channel tetramerisation domain containing 12b OS=Mus musculus OX=10090 GN=Kctd12b PE=1 SV=1
15	Q96CX2	1.81e-13	71.2	325	0.140	0.111	KCD12_HUMAN BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1
16	Q6WVG3	3.50e-13	70.1	327	0.140	0.110	KCD12_MOUSE BTB/POZ domain-containing protein KCTD12 OS=Mus musculus OX=10090 GN=Kctd12 PE=1 SV=1
17	Q50H33	3.84e-13	70.9	476	0.156	0.084	KCTD8_MOUSE BTB/POZ domain-containing protein KCTD8 OS=Mus musculus OX=10090 GN=Kctd8 PE=1 SV=1
18	Q5DTY9	3.96e-13	70.5	427	0.300	0.180	KCD16_MOUSE BTB/POZ domain-containing protein KCTD16 OS=Mus musculus OX=10090 GN=Kctd16 PE=1 SV=2
19	Q68DU8	4.66e-13	70.5	428	0.152	0.091	KCD16_HUMAN BTB/POZ domain-containing protein KCTD16 OS=Homo sapiens OX=9606 GN=KCTD16 PE=1 SV=1
20	Q17RG1	6.61e-13	70.5	926	0.152	0.042	KCD19_HUMAN BTB/POZ domain-containing protein KCTD19 OS=Homo sapiens OX=9606 GN=KCTD19 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02214 BTB_2	6.9e-14	63.3	BTB/POZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007956

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008585	0.889	Transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
2	61853.ENSNLEP00000004811	0.844	Transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
3	61853.ENSNLEP00000000590	0.824	Transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
4	61853.ENSNLEP00000013454	0.777	Transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon)
5	61853.ENSNLEP00000019703	0.691	CCAAT/enhancer binding protein (C/EBP), zeta
6	61853.ENSNLEP00000004593	0.683	Activating transcription factor 7 interacting protein
7	61853.ENSNLEP00000013353	0.677	Zinc finger, MYM-type 4
8	61853.ENSNLEP00000004824	0.674	Transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
9	61853.ENSNLEP00000006159	0.638	annotation not available
10	61853.ENSNLEP00000014989	0.638	Transforming, acidic coiled-coil containing protein 1
11	61853.ENSNLEP00000001495	0.637	Zinc finger, MYM-type 3
12	61853.ENSNLEP00000021468	0.525	BTB (POZ) domain containing 10
13	61853.ENSNLEP00000022108	0.521	Small integral membrane protein 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0140110	0.817	transcription regulator activity
GO:0003712	0.748	transcription coregulator activity
GO:0003714	0.322	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0050789	0.975	regulation of biological process
GO:0050794	0.943	regulation of cellular process
GO:0031323	0.855	regulation of cellular metabolic process
GO:0019219	0.846	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.834	regulation of RNA biosynthetic process
GO:0048519	0.799	negative regulation of biological process
GO:0006355	0.791	regulation of DNA-templated transcription
GO:0048523	0.711	negative regulation of cellular process
GO:0009987	0.620	cellular process
GO:0009892	0.595	negative regulation of metabolic process
GO:0045934	0.533	negative regulation of nucleobase-containing compound metabolic process
GO:0032501	0.427	multicellular organismal process
GO:0010605	0.393	negative regulation of macromolecule metabolic process
GO:0032502	0.377	developmental process
GO:0007275	0.366	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.994	membrane-enclosed lumen
GO:0031981	0.984	nuclear lumen
GO:0005654	0.920	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]