StarFunc result for job id Q71H61

User Input

>input (639 residues)
MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKS
YCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGR
EITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFA
VEIMPEWVFVGLVLLGVFLFFVLVGICWCQCCPHSCCCYVRCPCCPDSCCCPQALYEAGK
AAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPPPLAPSDSTGGSHSVRKGYRI
QADKERDSMKVLYYVEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFRQSFHQMRSKQ
FPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHSQPRSKSEMLSRKNFAT
GVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQ
RSRSREPLTDADRGWAFSPARRRPAEDAHLPRLVSRTPGTAPKYDHSYLGSARERQARPE
GASRGGSLETPSKRSAQLGPRSASYYAWSPPGTYKAGSSQDDQEDASDDALPPYSELELT
RGPSYRGRDLPYHSNSEKKRKKEPAKKTNDFPTRMSLVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5TVM2	0.387	0.376	8.355E-83	661	0.909	0.879	B5TVM2.pdb.gz	ILDR2_MOUSE Immunoglobulin-like domain-containing receptor 2 OS=Mus musculus OX=10090 GN=Ildr2 PE=1 SV=2
2	AFDB:F1R600	0.315	0.337	1.348E-37	590	0.338	0.366	F1R600.pdb.gz
3	PDB:3oaiA	0.158	0.204	1.490E-6	488	0.036	0.047	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
4	PDB:3zhlA	0.144	0.615	8.943E-5	121	0.034	0.182	3zhlA.pdb.gz
5	PDB:1igtB	0.144	0.201	1.004E-4	444	0.036	0.052	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
6	AFDB:O35569	0.130	0.099	1.231E-4	868	0.142	0.105	O35569.pdb.gz	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
7	PDB:5ir3A	0.131	0.635	1.339E-4	111	0.039	0.225	5ir3A.pdb.gz
8	PDB:1ohqA	0.142	0.628	1.419E-4	120	0.038	0.200	1ohqA.pdb.gz
9	PDB:5c6wJ	0.148	0.375	1.503E-4	238	0.031	0.084	5c6wJ.pdb.gz
10	PDB:6hd8A	0.137	0.186	1.503E-4	461	0.039	0.054	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
11	PDB:5nqkB	0.137	0.332	1.787E-4	242	0.030	0.079	5nqkB.pdb.gz	human 199.16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2
12	PDB:1igaA	0.149	0.197	1.893E-4	475	0.031	0.042	1igaA.pdb.gz
13	AFDB:Q9JM61	0.061	0.051	1.952E-4	851	0.152	0.114	Q9JM61.pdb.gz	THSD1_MOUSE Thrombospondin type-1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Thsd1 PE=1 SV=2
14	PDB:6rulA	0.129	0.282	3.002E-4	276	0.039	0.091	6rulA.pdb.gz	Chemogenetic Control of Nanobodies.
15	AFDB:O97174	0.139	0.098	5.839E-4	975	0.127	0.083	O97174.pdb.gz	O97174_DROME EG:163A10.1 protein OS=Drosophila melanogaster OX=7227 GN=kirre PE=1 SV=1
16	AFDB:Q924C5	0.136	0.057	8.253E-4	1678	0.125	0.048	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
17	AFDB:A0A0R4IBM0	0.138	0.122	1.039E-3	730	0.128	0.112	A0A0R4IBM0.pdb.gz	A0A0R4IBM0_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
18	AFDB:Q6WRI0	0.119	0.032	2.200E-3	2623	0.108	0.026	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
19	AFDB:Q90X22	0.081	0.044	2.200E-3	1276	0.135	0.067	Q90X22.pdb.gz
20	AFDB:B9VQL3	0.139	0.155	3.697E-3	565	0.141	0.159	B9VQL3.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5TVM2	0.0	1102	661	0.908	0.877	ILDR2_MOUSE Immunoglobulin-like domain-containing receptor 2 OS=Mus musculus OX=10090 GN=Ildr2 PE=1 SV=2
2	Q71H61	0.0	1319	639	1.000	1.000	ILDR2_HUMAN Immunoglobulin-like domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=ILDR2 PE=1 SV=1
3	Q86X29	1.10e-73	251	649	0.286	0.282	LSR_HUMAN Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4
4	Q99KG5	1.28e-69	239	594	0.268	0.288	LSR_MOUSE Lipolysis-stimulated lipoprotein receptor OS=Mus musculus OX=10090 GN=Lsr PE=1 SV=1
5	Q9WU74	1.63e-66	230	593	0.266	0.287	LSR_RAT Lipolysis-stimulated lipoprotein receptor OS=Rattus norvegicus OX=10116 GN=Lsr PE=1 SV=1
6	A0A0R4IPT5	1.38e-58	209	618	0.246	0.254	A0A0R4IPT5_DANRE Lipolysis-stimulated lipoprotein receptor OS=Danio rerio OX=7955 GN=Lisch7 PE=1 SV=3
7	A0A0R4ICU6	3.75e-46	174	599	0.230	0.245	A0A0R4ICU6_DANRE Lipolysis-stimulated lipoprotein receptor OS=Danio rerio OX=7955 GN=Lisch7 PE=1 SV=1
8	Q4V8Y3	1.43e-44	170	594	0.225	0.242	Q4V8Y3_DANRE Lipolysis-stimulated lipoprotein receptor precursor OS=Danio rerio OX=7955 GN=zgc:114089 PE=1 SV=1
9	Q86SU0	7.74e-22	102	546	0.196	0.229	ILDR1_HUMAN Immunoglobulin-like domain-containing receptor 1 OS=Homo sapiens OX=9606 GN=ILDR1 PE=1 SV=2
10	Q8CBR1	4.03e-21	99.8	537	0.182	0.216	ILDR1_MOUSE Immunoglobulin-like domain-containing receptor 1 OS=Mus musculus OX=10090 GN=Ildr1 PE=1 SV=2
11	Q99795	0.004	42.0	319	0.050	0.100	GPA33_HUMAN Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1
12	Q9D2J4	0.026	39.7	407	0.039	0.061	VSIG1_MOUSE V-set and immunoglobulin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Vsig1 PE=1 SV=1
13	Q86XK7	0.032	39.7	387	0.061	0.101	VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSIG1 PE=1 SV=1
14	Q3S3D7	0.40	36.6	1441	0.030	0.013	Q3S3D7_XENBO Neogenin variant 1 OS=Xenopus borealis OX=8354 PE=2 SV=1
15	E1JHB7	0.53	36.2	1577	0.055	0.022	E1JHB7_DROME PDGF- and VEGF-receptor related, isoform J OS=Drosophila melanogaster OX=7227 GN=Pvr PE=1 SV=1
16	M9PCX2	0.57	35.8	1568	0.055	0.022	M9PCX2_DROME PDGF- and VEGF-receptor related, isoform M OS=Drosophila melanogaster OX=7227 GN=Pvr PE=1 SV=1
17	E1JHB6	0.59	35.8	1528	0.055	0.023	E1JHB6_DROME FI18308p1 OS=Drosophila melanogaster OX=7227 GN=Pvr PE=1 SV=1
18	Q8I0P7	0.59	35.8	678	0.049	0.046	PDE3_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-3 OS=Caenorhabditis elegans OX=6239 GN=pde-3 PE=3 SV=4
19	Q8T4L8	0.59	35.8	1503	0.055	0.023	Q8T4L8_DROME VEGF-receptor B OS=Drosophila melanogaster OX=7227 GN=Pvr PE=2 SV=1
20	Q95P10	0.60	35.8	1509	0.055	0.023	Q95P10_DROME PDGF/VEGF receptor OS=Drosophila melanogaster OX=7227 GN=Pvr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05624 LSR	1.5e-19	81.1	Lipolysis stimulated receptor (LSR)
2	PF07686 V-set	0.024	26.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271417

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323264	0.794	MARVEL domain-containing protein 2
2	9606.ENSP00000297071	0.695	Transformer-2 protein homolog alpha
3	9606.ENSP00000320797	0.624	Tubulin delta chain
4	9606.ENSP00000268896	0.604	Phosphatidylcholine transfer protein
5	9606.ENSP00000416959	0.599	Transformer-2 protein homolog beta
6	9606.ENSP00000261439	0.571	TBC1 domain family member 1
7	9606.ENSP00000361791	0.565	Zinc finger protein ZFP69
8	9606.ENSP00000339314	0.557	Zinc finger protein 70
9	9606.ENSP00000424226	0.510	Teneurin-3
10	9606.ENSP00000452123	0.503	Serine/arginine-rich splicing factor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0022408	0.987	negative regulation of cell-cell adhesion
GO:1903037	0.986	regulation of leukocyte cell-cell adhesion
GO:0051250	0.931	negative regulation of lymphocyte activation
GO:0009987	0.902	cellular process
GO:1903038	0.879	negative regulation of leukocyte cell-cell adhesion
GO:0050863	0.822	regulation of T cell activation
GO:0050868	0.706	negative regulation of T cell activation
GO:0010468	0.479	regulation of gene expression
GO:0080090	0.477	regulation of primary metabolic process
GO:0032502	0.466	developmental process
GO:0048856	0.462	anatomical structure development
GO:0051171	0.448	regulation of nitrogen compound metabolic process
GO:0032501	0.434	multicellular organismal process
GO:0031323	0.426	regulation of cellular metabolic process
GO:0071704	0.421	organic substance metabolic process
GO:0050896	0.407	response to stimulus
GO:0051252	0.370	regulation of RNA metabolic process
GO:0051179	0.336	localization
GO:0043170	0.319	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070160	0.997	tight junction
GO:0005737	0.819	cytoplasm
GO:0016020	0.744	membrane
GO:0005634	0.410	nucleus
GO:0071944	0.321	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]