StarFunc result for job id Q75QN2

User Input

>input (995 residues)
MSAEAADREAATSSRPCTPPQTCWFEFLLEESLLEKHLRKPCPDPAPVQLIVQFLEQASK
PSVNEQNQVQPPPDNKRNRILKLLALKVAAHLKWDLDILEKSLSVPVLNMLLNELLCISK
VPPGTKHVDMDLATLPPTTAMAVLLYNRWAIRTIVQSSFPVKQAKPGPPQLSVMNQMQQE
KELTENILKVLKEQAADSILVLEAALKLNKDLYVHTMRTLDLLAMEPGMVNGETESSTAG
LKVKTEEMQCQVCYDLGAAYFQQGSTNSAVYENAREKFFRTKELIAEIGSLSLHCTIDEK
RLAGYCQACDVLVPSSDSTSQQLTPYSQVHICLRSGNYQEVIQIFIEDNLTLSLPVQFRQ
SVLRELFKKAQQGNEALDEICFKVCACNTVRDILEGRTISVQFNQLFLRPNKEKIDFLLE
VCSRSVNLEKASESLKGNMAAFLKNVCLGLEDLQYVFMISSHELFITLLKDEERKLLVDQ
MRKRSPRVNLCIKPVTSFYDIPASASVNIGQLEHQLILSVDPWRIRQILIELHGMTSERQ
FWTVSNKWEVPSVYSGVILGIKDNLTRDLVYILMAKGLHCSTVKDFSHAKQLFAACLELV
TEFSPKLRQVMLNEMLLLDIHTHEAGTGQAGERPPSDLISRVRGYLEMRLPDIPLRQVIA
EECVAFMLNWRENEYLTLQVPAFLLQSNPYVKLGQLLAATCKELPGPKESRRTAKDLWEV
VVQICSVSSQHKRGNDGRVSLIKQRESTLGIMYRSELLSFIKKLREPLVLTIILSLFVKL
HNVREDIVNDITAEHISIWPSSIPNLQSVDFEAVAITVKELVRYTLSINPNNHSWLIIQA
DIYFATNQYSAALHYYLQAGAVCSDFFNKAVPPDVYTDQVIKRMIKCCSLLNCHTQVAIL
CQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKA
IGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q75QN2	1.000	1.000	0.000	995	1.000	1.000	Q75QN2.pdb.gz	INT8_HUMAN Integrator complex subunit 8 OS=Homo sapiens OX=9606 GN=INTS8 PE=1 SV=1
2	PDB:7pksh	0.480	0.538	7.887E-87	887	0.888	0.997	7pksh.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
3	PDB:7cunH	0.488	0.531	4.982E-71	912	0.907	0.989	7cunH.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
4	AFDB:A1ZAK1	0.448	0.442	1.727E-37	1007	0.271	0.268	A1ZAK1.pdb.gz	INT8_DROME Integrator complex subunit 8 OS=Drosophila melanogaster OX=7227 GN=IntS8 PE=1 SV=1
5	AFDB:Q9ULT0	0.130	0.144	2.939E-6	858	0.125	0.145	Q9ULT0.pdb.gz	TTC7A_HUMAN Tetratricopeptide repeat protein 7A OS=Homo sapiens OX=9606 GN=TTC7A PE=1 SV=3
6	AFDB:Q8BGB2	0.141	0.156	1.446E-5	858	0.127	0.147	Q8BGB2.pdb.gz	TTC7A_MOUSE Tetratricopeptide repeat protein 7A OS=Mus musculus OX=10090 GN=Ttc7a PE=1 SV=1
7	AFDB:O94441	0.114	0.126	1.240E-4	862	0.119	0.137	O94441.pdb.gz	YPP1_SCHPO Putative cargo-transport protein ypp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypp1 PE=1 SV=1
8	AFDB:P89105	0.148	0.139	1.335E-4	1077	0.110	0.101	P89105.pdb.gz	CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTR9 PE=1 SV=3
9	AFDB:Q96AY4	0.161	0.082	1.863E-4	2481	0.129	0.052	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
10	AFDB:Q9CB03	0.147	0.189	2.006E-4	694	0.099	0.143	Q9CB03.pdb.gz	NPGR1_ARATH Protein NPGR1 OS=Arabidopsis thaliana OX=3702 GN=NPGR1 PE=1 SV=1
11	AFDB:Q9VVU6	0.107	0.112	2.161E-4	931	0.113	0.120	Q9VVU6.pdb.gz	Q9VVU6_DROME Pre-mRNA-processing factor 6 OS=Drosophila melanogaster OX=7227 GN=Prp6 PE=1 SV=2
12	PDB:8a2qB	0.160	0.150	2.369E-4	1084	0.127	0.116	8a2qB.pdb.gz
13	AFDB:Q57WP4	0.162	0.218	2.906E-4	673	0.111	0.163	Q57WP4.pdb.gz	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
14	PDB:6bq1B	0.144	0.181	3.071E-4	728	0.085	0.117	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
15	PDB:2xwuB	0.157	0.167	3.696E-4	910	0.117	0.127	2xwuB.pdb.gz
16	PDB:4bujB	0.115	0.094	4.286E-4	1367	0.119	0.086	4bujB.pdb.gz
17	PDB:6tc0C	0.139	0.140	1.627E-3	994	0.138	0.138	6tc0C.pdb.gz
18	PDB:5yu7A	0.150	0.139	2.032E-3	1118	0.109	0.097	5yu7A.pdb.gz
19	PDB:6vaeA	0.101	0.091	2.032E-3	1198	0.148	0.123	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
20	PDB:6q82A	0.140	0.139	2.108E-3	1027	0.138	0.133	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q75QN2	0.0	2060	995	1.000	1.000	INT8_HUMAN Integrator complex subunit 8 OS=Homo sapiens OX=9606 GN=INTS8 PE=1 SV=1
2	A1ZAK1	5.84e-79	280	1007	0.277	0.274	INT8_DROME Integrator complex subunit 8 OS=Drosophila melanogaster OX=7227 GN=IntS8 PE=1 SV=1
3	D3Z5S8	1.2	35.4	447	0.031	0.069	TET5A_MOUSE Terminal nucleotidyltransferase 5A OS=Mus musculus OX=10090 GN=Tent5a PE=1 SV=2
4	Q96IP4	5.3	33.1	442	0.030	0.068	TET5A_HUMAN Terminal nucleotidyltransferase 5A OS=Homo sapiens OX=9606 GN=TENT5A PE=1 SV=2
5	Q57WP4	7.5	32.7	673	0.013	0.019	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09657 Cas_Csx8	1.1e+02	13.2	CRISPR-associated protein Csx8 (Cas_Csx8)
2	PF00515 TPR_1	41	15.4	Tetratricopeptide repeat
3	PF13414 TPR_11	1.8e+02	13.2	TPR repeat
4	PF07719 TPR_2	1.2	20.4	Tetratricopeptide repeat
5	PF13176 TPR_7	1.2e+02	14.1	Tetratricopeptide repeat
6	PF13181 TPR_8	1.2e+02	14.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355961	0.999	Integrator complex subunit 7
2	9606.ENSP00000414237	0.998	Integrator complex subunit 2
3	9606.ENSP00000327889	0.996	Integrator complex subunit 5
4	9606.ENSP00000385722	0.995	Integrator complex subunit 1
5	9606.ENSP00000429065	0.993	Integrator complex subunit 9
6	9606.ENSP00000434466	0.992	Integrator complex subunit 4
7	9606.ENSP00000445001	0.991	Integrator complex subunit 11
8	9606.ENSP00000310260	0.987	Integrator complex subunit 6
9	9606.ENSP00000381064	0.975	Integrator complex subunit 10
10	9606.ENSP00000318641	0.958	Integrator complex subunit 3
11	9606.ENSP00000415433	0.956	Integrator complex subunit 12
12	9606.ENSP00000408429	0.955	Integrator complex subunit 14
13	9606.ENSP00000261191	0.891	Integrator complex subunit 13
14	9606.ENSP00000418447	0.872	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
15	9606.ENSP00000480158	0.819	DNA-directed RNA polymerase II subunit RPB1
16	9606.ENSP00000282516	0.746	Nipped-B-like protein
17	9606.ENSP00000373713	0.744	Phosphatidylinositide phosphatase SAC1
18	9606.ENSP00000229266	0.730	Cholinephosphotransferase 1
19	9606.ENSP00000359788	0.727	Integrator complex subunit 6-like
20	9606.ENSP00000316527	0.720	Zinc finger protein 609

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0090304	0.985	nucleic acid metabolic process
GO:0016073	0.979	snRNA metabolic process
GO:0010467	0.978	gene expression
GO:0006396	0.953	RNA processing
GO:0034470	0.941	ncRNA processing
GO:0016180	0.907	snRNA processing
GO:0065007	0.418	biological regulation
GO:0050789	0.387	regulation of biological process
GO:0050794	0.329	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005737	0.924	cytoplasm
GO:0032039	0.681	integrator complex
GO:0005829	0.520	cytosol
GO:0043232	0.417	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]