StarFunc result for job id Q75T13

User Input

>input (922 residues)
MFLHSVNLWNLAFYVFMVFLATLGLWDVFFGFEENKCSMSYMFEYPEYQKIELPKKLAKR
YPAYELYLYGEGSYAEEHKILPLTGIPVLFLPGNAGSYKQVRSIGSIALRKAEDIDFKYH
FDFFSVNFNEELVALYGGSLQKQTKFVHECIKTILKLYKGQEFAPKSVAIIGHSMGGLVA
RALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSV
AGGFRDYQVRSGLTFLPKLSHHTSALSVVSSAVPKTWVSTDHLSIVWCKQLQLTTVRAFF
DLIDADTKQITQNSKKKLSVLYHHFIRHPSKHFEENPAIISDLTGTSMWVLVKVSKWTYV
AYNESEKIYFTFPLENHRKIYTHVYCQSTMLDTNSWIFACINSTSMCLQGVDLSWKAELL
PTIKYLTLRLQDYPSLSHLVVYVPSVRGSKFVVDCEFFKKEKRYIQLPVTHLFSFGLSSR
KVVLNTNGLYYNLELLNFGQIYQAFKINVVSKCSAVKEEITSIYRLHIPWSYEDSLTIAQ
APSSTEISLKLHIAQPENNTHVALFKMYTSSDCRYEVTVKTSFSQILGQVVRFHGGALPA
YVVSNILLAYRGQLYSLFSTGCCLEYATMLDKEAKPYKVDPFVIIIKFLLGYKWFKELWD
VLLLPELDAVILTCQSMCFPLISLILFLFGTCTAYWSGLLSSASVRLLSSLWLALKRPSE
LPKDIKMISPDLPFLTIVLIIVSWTTCGALAILLSYLYYVFKVVHLQASLTTFKNSQPVN
PKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHSTVINLLTWIVLLSMPSLIYWLKN
LRYYFKLNPDPCKPLAFILIPTMAILGNTYTVSIKSSKLLKTTSQFPLPLAVGVIAFGSA
HLYRLPCFVFIPLLLHALCNFM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UUQ7	0.992	0.992	0.000	922	0.903	0.903	Q3UUQ7.pdb.gz	PGAP1_MOUSE GPI inositol-deacylase OS=Mus musculus OX=10090 GN=Pgap1 PE=1 SV=3
2	AFDB:P43571	0.800	0.723	3.899E-44	1029	0.193	0.173	P43571.pdb.gz	BST1_YEAST GPI inositol-deacylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BST1 PE=1 SV=1
3	AFDB:F4IWG2	0.741	0.622	1.553E-43	1121	0.204	0.168	F4IWG2.pdb.gz	F4IWG2_ARATH GPI inositol-deacylase OS=Arabidopsis thaliana OX=3702 GN=At3g27325 PE=1 SV=1
4	AFDB:Q9UT41	0.790	0.646	2.536E-43	1142	0.204	0.165	Q9UT41.pdb.gz	BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bst1 PE=3 SV=1
5	AFDB:Q582X3	0.478	0.550	6.459E-15	781	0.148	0.174	Q582X3.pdb.gz	Q582X3_TRYB2 GPI inositol-deacylase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.210 PE=3 SV=1
6	AFDB:Q38DX1	0.401	0.311	7.175E-14	1292	0.146	0.104	Q38DX1.pdb.gz	Q38DX1_TRYB2 PGAP1-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1830 PE=4 SV=1
7	AFDB:Q9GYF0	0.162	0.186	1.272E-5	756	0.092	0.112	Q9GYF0.pdb.gz	CHUP1_CAEEL Cholesterol uptake protein 1 OS=Caenorhabditis elegans OX=6239 GN=chup-1 PE=1 SV=1
8	AFDB:P78898	0.195	0.379	4.636E-5	443	0.050	0.104	P78898.pdb.gz	TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16A3.12c PE=3 SV=2
9	PDB:4e15B	0.171	0.467	6.559E-5	303	0.043	0.132	4e15B.pdb.gz
10	AFDB:Q94AS5	0.179	0.349	7.915E-5	427	0.053	0.115	Q94AS5.pdb.gz	ICME_ARATH Isoprenylcysteine alpha-carbonyl methylesterase ICME OS=Arabidopsis thaliana OX=3702 GN=ICME PE=1 SV=1
11	AFDB:P34163	0.189	0.300	9.048E-5	548	0.059	0.099	P34163.pdb.gz	TGL1_YEAST Sterol esterase TGL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TGL1 PE=1 SV=1
12	PDB:5jzsB	0.173	0.482	1.829E-4	284	0.038	0.123	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
13	PDB:3lxuX	0.135	0.109	2.987E-4	1217	0.043	0.033	3lxuX.pdb.gz
14	PDB:5l2pA	0.198	0.498	3.903E-4	306	0.047	0.141	5l2pA.pdb.gz
15	PDB:2y6vC	0.178	0.384	5.100E-4	377	0.057	0.141	2y6vC.pdb.gz
16	PDB:4uflA	0.098	0.129	5.100E-4	641	0.056	0.081	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
17	PDB:6l4hA	0.155	0.421	6.374E-4	289	0.040	0.128	6l4hA.pdb.gz
18	PDB:2wm2C	0.170	0.467	6.664E-4	277	0.036	0.119	2wm2C.pdb.gz	Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
19	PDB:7qvhB	0.172	0.497	6.968E-4	272	0.028	0.096	7qvhB.pdb.gz
20	PDB:5xg0C	0.175	0.523	7.965E-4	268	0.034	0.116	5xg0C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UUQ7	0.0	1748	922	0.905	0.905	PGAP1_MOUSE GPI inositol-deacylase OS=Mus musculus OX=10090 GN=Pgap1 PE=1 SV=3
2	Q75T13	0.0	1896	922	1.000	1.000	PGAP1_HUMAN GPI inositol-deacylase OS=Homo sapiens OX=9606 GN=PGAP1 PE=1 SV=1
3	Q765A7	0.0	1741	922	0.898	0.898	PGAP1_RAT GPI inositol-deacylase OS=Rattus norvegicus OX=10116 GN=Pgap1 PE=1 SV=1
4	Q9UT41	1.97e-46	183	1142	0.118	0.095	BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bst1 PE=3 SV=1
5	P43571	9.14e-43	171	1029	0.115	0.103	BST1_YEAST GPI inositol-deacylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BST1 PE=1 SV=1
6	F4IWG2	6.59e-36	149	1121	0.110	0.090	F4IWG2_ARATH GPI inositol-deacylase OS=Arabidopsis thaliana OX=3702 GN=At3g27325 PE=1 SV=1
7	Q59VP0	3.94e-21	99.0	390	0.102	0.241	BST1_CANAL GPI inositol-deacylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BST1 PE=3 SV=2
8	Q582X3	4.43e-10	65.9	781	0.064	0.076	Q582X3_TRYB2 GPI inositol-deacylase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.210 PE=3 SV=1
9	Q9FN84	0.046	39.3	309	0.036	0.107	Q9FN84_ARATH GPI inositol-deacylase OS=Arabidopsis thaliana OX=3702 GN=MVA3.2 PE=1 SV=1
10	P54857	0.31	37.0	326	0.030	0.086	TGL2_YEAST Triacylglycerol lipase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TGL2 PE=1 SV=1
11	P26358	4.8	33.5	1616	0.017	0.010	DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	45	15.1	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	51	15.9	Alpha/beta hydrolase family
3	PF08538 DUF1749	2.9e+02	11.9	Protein of unknown function (DUF1749)
4	PF05057 DUF676	6.6	17.7	Putative serine esterase (DUF676)
5	PF00756 Esterase	4.4e+02	11.9	Putative esterase
6	PF12146 Hydrolase_4	50	14.6	Serine aminopeptidase, S33
7	PF01764 Lipase_3	3.5e+02	12.4	Lipase (class 3)
8	PF02089 Palm_thioest	0.42	21.9	Palmitoyl protein thioesterase
9	PF00326 Peptidase_S9	4.9e+02	11.6	Prolyl oligopeptidase family
10	PF07819 PGAP1	4.1e-78	273.8	PGAP1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346809

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279036	0.982	GPI transamidase component PIG-T
2	9606.ENSP00000347206	0.980	Glycosylphosphatidylinositol anchor attachment 1 protein
3	9606.ENSP00000359848	0.977	GPI-anchor transamidase
4	9606.ENSP00000217446	0.964	Phosphatidylinositol glycan anchor biosynthesis class U protein
5	9606.ENSP00000309430	0.962	GPI transamidase component PIG-S
6	9606.ENSP00000339328	0.904	Urokinase plasminogen activator surface receptor
7	9606.ENSP00000300658	0.887	Post-GPI attachment to proteins factor 3
8	9606.ENSP00000465894	0.846	Metallophosphoesterase 1
9	9606.ENSP00000357069	0.820	GPI mannosyltransferase 1
10	9606.ENSP00000369820	0.819	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
11	9606.ENSP00000164305	0.818	GPI mannosyltransferase 3
12	9606.ENSP00000482202	0.797	Phosphatidylinositol-glycan biosynthesis class W protein
13	9606.ENSP00000350263	0.776	GPI ethanolamine phosphate transferase 1
14	9606.ENSP00000356702	0.771	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
15	9606.ENSP00000356030	0.764	Complement decay-accelerating factor
16	9606.ENSP00000278243	0.762	Post-GPI attachment to proteins factor 2
17	9606.ENSP00000420037	0.672	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
18	9606.ENSP00000415203	0.663	GPI ethanolamine phosphate transferase 2
19	9606.ENSP00000363260	0.657	GPI mannosyltransferase 2
20	9606.ENSP00000225609	0.650	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0052689	1.000	carboxylic ester hydrolase activity
GO:0050185	0.972	phosphatidylinositol deacylase activity
GO:0005488	0.441	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006506	0.995	GPI anchor biosynthetic process
GO:0050789	0.345	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.999	membrane
GO:0031090	0.979	organelle membrane
GO:0042175	0.962	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.955	endoplasmic reticulum subcompartment
GO:0005789	0.954	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	1.000	Carboxylic ester hydrolases.
RHEA:18001	0.972	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + H2O = a 1-acyl-sn-glycero-3-phospho-(1D-myo-inositol) + a fatty acid + H(+)
EC:3.1.1.52	0.972	phosphatidylinositol deacylase.

[back to server]