StarFunc result for job id Q765P7

User Input

>input (747 residues)
METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKV
ADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQ
LDKDHAKEYKRARHEIKKKSSDTLKLQKKARKELLGKGDLQPQLDSALQDVNDMYLLLEE
TEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPP
ASEQVIKDLKGSDYSWSYQTPPSSPSSSSSRKSSMCSAPSSSSSAKGGGAPWPGGAQTYS
PSSTCRYRSLAQPATTTARLSSVSSHDSGFVSQDATYSKPPSPMPSDITSQKSSSSASSE
ASETCQSVSECSSPTSDWSKVGSHEQPSGATLQRRKDRVELLRDTEPGPASGGTLGPSGE
EAPRPRMSPATIAAKHGEEVSPAASDLAMVLTRGLSLEHQKSSRDSLQYSSGYSTQTTTP
SCSEDTIPSQGSDYDCYSVNGDADSEGPPEFDKSSTIPRNSNIAQNYRRLIQTKRPASTA
GLPTAGLPTATGLPSGAPPGVATIRRTPSTKPTVRRALSSAGPIPIRPPIVPVKTPTVPD
SPGYMGPTRAGSEECVFYTDETASPLAPDLAKASPKRLSLPNTAWGSPSPEAAGYPGAGA
EDEQQQLAANRHSLVEKLGELVAGAHALGEGQFPFPTALSATPTEETPTPPPAATSDPPA
EDMLVAIRRGVRLRRTVTNDRSAPRIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q765P7	0.999	0.999	3.158E-89	747	1.000	1.000	Q765P7.pdb.gz	MTSS2_HUMAN Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1
2	AFDB:Q6P9S0	0.441	0.458	1.102E-78	715	0.912	0.952	Q6P9S0.pdb.gz	MTSS2_MOUSE Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1
3	AFDB:Q8R1S4	0.406	0.401	3.119E-50	759	0.584	0.574	Q8R1S4.pdb.gz	MTSS1_MOUSE Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1
4	AFDB:A0A0B4JCZ8	0.331	0.125	2.024E-27	2028	0.311	0.114	A0A0B4JCZ8.pdb.gz	A0A0B4JCZ8_DROME Missing-in-metastasis, isoform F OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
5	AFDB:A0A0B4KEU9	0.331	0.308	4.725E-27	804	0.299	0.277	A0A0B4KEU9.pdb.gz	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
6	AFDB:A0A0B4K822	0.331	0.218	9.412E-27	1136	0.286	0.188	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	AFDB:A0A0B4JD47	0.337	0.259	3.021E-26	977	0.289	0.221	A0A0B4JD47.pdb.gz	A0A0B4JD47_DROME Missing-in-metastasis, isoform E OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
8	AFDB:E1JGY9	0.330	0.260	4.616E-26	950	0.323	0.254	E1JGY9.pdb.gz	E1JGY9_DROME Missing-in-metastasis, isoform D OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
9	AFDB:Q95Y95	0.255	0.289	6.942E-14	652	0.198	0.227	Q95Y95.pdb.gz	Q95Y95_CAEEL IMD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M04F3.5 PE=1 SV=2
10	AFDB:A0A0B4KFZ2	0.195	0.135	6.865E-9	1161	0.150	0.096	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
11	PDB:6ikoA	0.151	0.247	5.035E-4	303	0.041	0.102	6ikoA.pdb.gz
12	PDB:3hajA	0.123	0.294	3.773E-3	286	0.024	0.063	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
13	PDB:4kxrB	0.119	0.394	3.887E-2	174	0.033	0.144	4kxrB.pdb.gz
14	PDB:7p54A	0.100	0.149	6.604E-2	397	0.044	0.083	7p54A.pdb.gz
15	PDB:6xz6A	0.095	0.213	6.963E-2	213	0.040	0.141	6xz6A.pdb.gz
16	PDB:6q0xA	0.167	0.291	8.607E-2	373	0.032	0.064	6q0xA.pdb.gz
17	PDB:5lkiA	0.153	0.090	9.570E-2	1427	0.044	0.023	5lkiA.pdb.gz
18	PDB:6sueA	0.109	0.041	1.626E-1	2292	0.025	0.008	6sueA.pdb.gz
19	PDB:1qoyA	0.105	0.216	1.906E-1	303	0.043	0.106	1qoyA.pdb.gz
20	PDB:7vojA	0.053	0.091	2.762E-1	400	0.036	0.068	7vojA.pdb.gz	Structural basis of ALMT1-mediated aluminum resistance in Arabidopsis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43312	0.0	750	755	0.598	0.592	MTSS1_HUMAN Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE=1 SV=2
2	Q6P9S0	0.0	1238	715	0.913	0.954	MTSS2_MOUSE Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1
3	Q765P7	0.0	1521	747	1.000	1.000	MTSS2_HUMAN Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1
4	Q8R1S4	0.0	742	759	0.589	0.580	MTSS1_MOUSE Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1
5	A0A0B4KEU9	1.60e-89	300	804	0.218	0.203	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
6	A0A0B4JD47	8.01e-89	301	977	0.217	0.166	A0A0B4JD47_DROME Missing-in-metastasis, isoform E OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	A0A0B4K822	6.21e-88	302	1136	0.217	0.143	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
8	E1JGY9	1.33e-87	298	950	0.181	0.142	E1JGY9_DROME Missing-in-metastasis, isoform D OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
9	A0A0B4KEK0	2.98e-87	302	1362	0.217	0.119	A0A0B4KEK0_DROME Missing-in-metastasis, isoform N OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
10	A0A0B4K7T1	5.20e-87	303	1868	0.218	0.087	A0A0B4K7T1_DROME Missing-in-metastasis, isoform J OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
11	A0A0B4KED3	6.62e-87	301	1299	0.218	0.125	A0A0B4KED3_DROME Missing-in-metastasis, isoform M OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
12	A0A0B4KEE8	9.14e-87	302	1802	0.218	0.090	A0A0B4KEE8_DROME Missing-in-metastasis, isoform L OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
13	A0A0B4K7H4	9.89e-87	302	1934	0.217	0.084	A0A0B4K7H4_DROME Missing-in-metastasis, isoform I OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
14	A0A0B4JCZ8	7.04e-86	300	2028	0.181	0.067	A0A0B4JCZ8_DROME Missing-in-metastasis, isoform F OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
15	A0A0B4JCQ4	9.56e-86	299	2009	0.181	0.067	A0A0B4JCQ4_DROME Missing-in-metastasis, isoform G OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
16	A1Z6S0	1.36e-85	299	2027	0.181	0.067	A1Z6S0_DROME Missing-in-metastasis, isoform C OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=2
17	A8DY50	2.05e-85	298	1654	0.181	0.082	A8DY50_DROME Missing-in-metastasis, isoform B OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
18	Q95Y95	1.11e-34	142	652	0.110	0.126	Q95Y95_CAEEL IMD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M04F3.5 PE=1 SV=2
19	Q6GMN2	1.26e-08	60.5	535	0.059	0.082	BAIP2_RAT Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Baiap2 PE=1 SV=1
20	Q60437	1.34e-08	60.5	521	0.063	0.090	BAIP2_CRIGR Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Cricetulus griseus OX=10029 GN=BAIAP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20551 DUF6765	5.9e+02	11.5	Family of unknown function (DUF6765)
2	PF08397 IMD	1.6e-99	343.3	IRSp53/MIM homology domain
3	PF03938 OmpH	4.2e+02	12.6	Outer membrane protein (OmpH-like)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341171

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391088	0.731	Protein unc-80 homolog
2	9606.ENSP00000360626	0.698	Potassium voltage-gated channel subfamily G member 1
3	9606.ENSP00000371085	0.684	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2
4	9606.ENSP00000363976	0.673	HLA class II histocompatibility antigen, DM alpha chain
5	9606.ENSP00000005260	0.624	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1
6	9606.ENSP00000233154	0.617	Cytoplasmic protein NCK2
7	9606.ENSP00000331682	0.559	Kelch-like protein 22
8	9606.ENSP00000345773	0.550	BEN domain containing 7
9	9606.ENSP00000482885	0.549	Phosphatidylinositol phosphatase PTPRQ
10	9606.ENSP00000283228	0.548	Receptor-type tyrosine-protein phosphatase R
11	9606.ENSP00000363642	0.533	Ribosome biogenesis protein BMS1 homolog
12	9606.ENSP00000308012	0.515	Polyadenylate-binding protein 5
13	9606.ENSP00000247977	0.504	F-box/LRR-repeat protein 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0051020	0.932	GTPase binding
GO:0031267	0.923	small GTPase binding
GO:0042802	0.920	identical protein binding
GO:0005543	0.886	phospholipid binding
GO:0030695	0.711	GTPase regulator activity
GO:0005096	0.655	GTPase activator activity
GO:0042803	0.349	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.987	biological regulation
GO:0071840	0.979	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0050794	0.972	regulation of cellular process
GO:0050896	0.885	response to stimulus
GO:0065009	0.504	regulation of molecular function
GO:0120036	0.482	plasma membrane bounded cell projection organization
GO:0009719	0.419	response to endogenous stimulus
GO:0070848	0.402	response to growth factor
GO:0048519	0.368	negative regulation of biological process
GO:0048523	0.358	negative regulation of cellular process
GO:0097581	0.331	lamellipodium organization
GO:0048518	0.305	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.998	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0071944	0.996	cell periphery
GO:0005886	0.994	plasma membrane
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0031982	0.925	vesicle
GO:0031252	0.910	cell leading edge
GO:0001726	0.891	ruffle
GO:0005856	0.837	cytoskeleton
GO:0005829	0.756	cytosol
GO:0015629	0.680	actin cytoskeleton
GO:0012505	0.511	endomembrane system
GO:0098590	0.478	plasma membrane region
GO:0031981	0.416	nuclear lumen
GO:0005654	0.387	nucleoplasm
GO:0032991	0.373	protein-containing complex
GO:0005938	0.337	cell cortex
GO:0031256	0.322	leading edge membrane
GO:0030054	0.320	cell junction
GO:0032587	0.301	ruffle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]