StarFunc result for job id Q76FK4

User Input

>input (1167 residues)
MKVNRETKRLYVGGLSQDISEADLQNQFSRFGEVSDVEIITRKDDQGNPQKVFAYINISV
AEADLKKCMSVLNKTKWKGGTLQIQLAKESFLHRLAQEREAAKAKKEESTTGNANLLEKT
GGVDFHMKAVPGTEVPGHKNWVVSKFGRVLPVLHLKNQHKRKIIKYDPSKYCHNLKKIGE
DFSNTIPISSLTWELEGGNDPMSKKRRGEFSDFHGPPKKIIKVQKDESSTGSLAMSTRPR
RVIERPPLTQQQAAQKRTCDSITPSKSSPVPVSDTQKLKNLPFKTSGLETAKKRNSISDD
DTDSEDELRMMIAKEENLQRTTQPSINESESDPFEVVRDDFKSGVHKLHSLIGLGIKNRV
SCHDSDDDIMRNDREYDSGDTDEIIAMKKNVAKVKNSTEFSQMEKSTKKTSFKNRENCEL
SDHCIKLQKRKSNVESALSHGLKSLNRKSPSHSSSSEDADSASELADSEGGEEYNAMMKN
CLRVNLTLADLEQLAGSDLKVPNEDTKSDGPETTTQCKFDRGSKSPKTPTGLRRGRQCIR
PAEIVASLLEGEENTCGKQKPKENNLKPKFQAFKGVGCLYEKESMKKSLKDSVASNNKDQ
NSMKHEDPSIISMEDGSPYVNGSLGEVTPCQHAKKANGPNYIQPQKRQTTFESQDRKAVS
PSSSEKRSKNPISRPLEGKKSLSLSAKTHNIGFDKDSCHSTTKTEASQEERSDSSGLTSL
KKSPKVSSKDTREIKTDFSLSISNSSDVSAKDKHAEDNEKRLAALEARQKAKEVQKKLVH
NALANLDGHPEDKPTHIIFGSDSECETEETSTQEQSHPGEEWVKESMGKTSGKLFDSSDD
DESDSEDDSNRFKIKPQFEGRAGQKLMDLQSHFGTDDRFRMDSRFLETDSEEEQEEVNEK
KTAEEEELAEEKKKALNVVQSVLQINLSNSTNRGSVAAKKFKDIIHYDPTKQDHATYERK
RDDKPKESKAKRKKKREEAEKLPEVSKEMYYNIAMDLKEIFQTTKYTSEKEEGTPWNEDC
GKEKPEEIQDPAALTSDAEQPSGFTFSFFDSDTKDIKEETYRVETVKPGKIVWQEDPRLQ
DSSSEEEDVTEETDHRNSSPGEASLLEKETTRFFFFSKNDERLQGSDLFWRGVGSNMSRN
SWEARTTNLRMDCRKKHKDAKRKMKPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UHX0	0.218	0.221	0.000	1147	0.634	0.645	Q3UHX0.pdb.gz	NOL8_MOUSE Nucleolar protein 8 OS=Mus musculus OX=10090 GN=Nol8 PE=1 SV=2
2	AFDB:Q76FK4	1.000	1.000	0.000	1167	1.000	1.000	Q76FK4.pdb.gz	NOL8_HUMAN Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8 PE=1 SV=1
3	AFDB:Q9FGT1	0.078	0.121	1.161E-9	748	0.111	0.172	Q9FGT1.pdb.gz	ROS3_ARATH Protein REPRESSOR OF SILENCING 3 OS=Arabidopsis thaliana OX=3702 GN=ROS3 PE=2 SV=1
4	PDB:6gd1A	0.065	0.364	8.245E-6	190	0.016	0.100	6gd1A.pdb.gz
5	PDB:7dvqY	0.064	0.451	1.636E-5	140	0.016	0.136	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
6	PDB:7ohxo	0.065	0.536	2.099E-5	112	0.018	0.188	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
7	PDB:5gm6V	0.068	0.501	2.530E-5	128	0.021	0.195	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
8	PDB:5xjcw	0.064	0.654	3.049E-5	91	0.014	0.176	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
9	PDB:6r5kH	0.063	0.177	5.019E-5	394	0.019	0.056	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
10	PDB:1hl6A	0.064	0.540	5.341E-5	119	0.015	0.143	1hl6A.pdb.gz
11	AFDB:Q14966	0.074	0.047	5.547E-5	1978	0.147	0.087	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
12	PDB:3lqvB	0.060	0.494	6.439E-5	115	0.018	0.183	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:6y53o	0.063	0.405	6.439E-5	160	0.018	0.131	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:5yzg1	0.063	0.281	7.293E-5	243	0.020	0.095	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
15	AFDB:F4JXH7	0.063	0.074	1.034E-4	987	0.128	0.151	F4JXH7.pdb.gz	F4JXH7_ARATH RNA binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g60170 PE=1 SV=1
16	AFDB:Q95YM8	0.045	0.035	1.811E-4	1598	0.123	0.089	Q95YM8.pdb.gz	MBLK1_APIME Mushroom body large-type Kenyon cell-specific protein 1 OS=Apis mellifera OX=7460 GN=Mblk-1 PE=1 SV=1
17	AFDB:Q9M1E4	0.068	0.080	1.811E-4	989	0.123	0.145	Q9M1E4.pdb.gz	Q9M1E4_ARATH RNA binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=F9K21.210 PE=1 SV=1
18	AFDB:Q7TSH4	0.063	0.069	3.824E-4	1004	0.110	0.127	Q7TSH4.pdb.gz	CP110_MOUSE Centriolar coiled-coil protein of 110 kDa OS=Mus musculus OX=10090 GN=Ccp110 PE=1 SV=1
19	AFDB:Q9UPS6	0.068	0.043	6.699E-4	1966	0.122	0.072	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3
20	AFDB:Q8CFT2	0.070	0.043	7.587E-4	1985	0.129	0.076	Q8CFT2.pdb.gz	SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus OX=10090 GN=Setd1b PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8WE42	0.0	1994	969	0.830	1.000	F8WE42_HUMAN Nucleolar protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=NOL8 PE=1 SV=8
2	Q3UHX0	0.0	1306	1147	0.635	0.646	NOL8_MOUSE Nucleolar protein 8 OS=Mus musculus OX=10090 GN=Nol8 PE=1 SV=2
3	Q76FK4	0.0	2405	1167	1.000	1.000	NOL8_HUMAN Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8 PE=1 SV=1
4	Q9HFE6	7.79e-19	93.6	478	0.053	0.130	YNW6_SCHPO Uncharacterized RNA-binding protein P16F5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP16F5.06 PE=1 SV=1
5	Q9FGT1	1.11e-10	68.6	748	0.033	0.052	ROS3_ARATH Protein REPRESSOR OF SILENCING 3 OS=Arabidopsis thaliana OX=3702 GN=ROS3 PE=2 SV=1
6	D3YXK2	1.38e-07	58.5	937	0.029	0.036	SAFB1_MOUSE Scaffold attachment factor B1 OS=Mus musculus OX=10090 GN=Safb PE=1 SV=2
7	O88453	5.93e-07	56.2	931	0.028	0.035	SAFB1_RAT Scaffold attachment factor B1 OS=Rattus norvegicus OX=10116 GN=Safb PE=1 SV=2
8	A5PJP2	6.29e-07	56.2	903	0.029	0.038	A5PJP2_BOVIN SAFB protein OS=Bos taurus OX=9913 GN=SAFB PE=2 SV=1
9	Q15424	6.35e-06	53.1	915	0.024	0.031	SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4
10	Q14151	4.88e-05	50.1	953	0.023	0.028	SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1
11	Q84TH4	2.37e-04	47.4	382	0.021	0.063	SR45A_ARATH Serine/arginine-rich splicing factor SR45a OS=Arabidopsis thaliana OX=3702 GN=SR45A PE=1 SV=1
12	Q9UNP9	3.11e-04	46.6	301	0.023	0.090	PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens OX=9606 GN=PPIE PE=1 SV=1
13	Q9CX86	4.68e-04	46.2	305	0.018	0.069	ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus OX=10090 GN=Hnrnpa0 PE=1 SV=1
14	Q7K1P7	6.36e-04	45.8	392	0.020	0.059	Q7K1P7_DROME LP03039p OS=Drosophila melanogaster OX=7227 GN=Saf-B PE=2 SV=1
15	Q13151	6.66e-04	45.4	305	0.018	0.069	ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1
16	Q80YR5	8.08e-04	46.2	991	0.020	0.023	SAFB2_MOUSE Scaffold attachment factor B2 OS=Mus musculus OX=10090 GN=Safb2 PE=1 SV=2
17	Q10422	0.001	44.7	297	0.021	0.084	YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC25G10.01 PE=1 SV=1
18	Q8IGV1	0.001	45.8	977	0.022	0.027	Q8IGV1_DROME RE24907p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Saf-B PE=2 SV=1
19	Q8IMV6	0.001	45.8	928	0.022	0.028	Q8IMV6_DROME Scaffold attachment factor B, isoform B OS=Drosophila melanogaster OX=7227 GN=Saf-B PE=1 SV=2
20	Q9NWH9	0.001	45.8	1034	0.018	0.020	SLTM_HUMAN SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	0.0022	29.1	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF16367 RRM_7	1.6	20.2	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254940	0.952	60S ribosome subunit biogenesis protein NIP7 homolog
2	9606.ENSP00000369899	0.868	Ras-related GTP-binding protein A
3	9606.ENSP00000362092	0.859	Ras-related GTP-binding protein C
4	9606.ENSP00000202816	0.840	ESF1 homolog
5	9606.ENSP00000372199	0.830	Nucleolar pre-ribosomal-associated protein 1
6	9606.ENSP00000358423	0.778	Ras-related GTP-binding protein D
7	9606.ENSP00000380495	0.772	ATP-dependent RNA helicase DDX51
8	9606.ENSP00000258243	0.758	URB2 ribosome biogenesis 2 homolog
9	9606.ENSP00000287996	0.734	Inositol-pentakisphosphate 2-kinase
10	9606.ENSP00000347188	0.716	BTB/POZ domain-containing protein KCTD6
11	9606.ENSP00000350698	0.696	Probable ATP-dependent RNA helicase DDX47
12	9606.ENSP00000233078	0.690	DAZ-associated protein 1
13	9606.ENSP00000365588	0.670	Mediator of DNA damage checkpoint protein 1
14	9606.ENSP00000364737	0.667	Centromere protein P
15	9606.ENSP00000378399	0.665	WD repeat-containing protein 89
16	9606.ENSP00000441913	0.665	Rho guanine nucleotide exchange factor 28
17	9606.ENSP00000334808	0.662	Ubiquitin carboxyl-terminal hydrolase 16
18	9606.ENSP00000243673	0.632	Probable G-protein coupled receptor 83
19	9606.ENSP00000364794	0.626	Isoleucine--tRNA ligase, cytoplasmic
20	9606.ENSP00000264279	0.620	Nucleolar protein 58

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0090304	0.981	nucleic acid metabolic process
GO:0071840	0.977	cellular component organization or biogenesis
GO:0010467	0.974	gene expression
GO:0016070	0.973	RNA metabolic process
GO:0022613	0.957	ribonucleoprotein complex biogenesis
GO:0034660	0.949	ncRNA metabolic process
GO:0016072	0.904	rRNA metabolic process
GO:0006396	0.904	RNA processing
GO:0042254	0.878	ribosome biogenesis
GO:0006364	0.864	rRNA processing
GO:0051179	0.696	localization
GO:0033036	0.683	macromolecule localization
GO:0070727	0.567	cellular macromolecule localization
GO:0008104	0.564	protein localization
GO:0033365	0.542	protein localization to organelle
GO:0050896	0.499	response to stimulus
GO:0050794	0.416	regulation of cellular process
GO:0034504	0.329	protein localization to nucleus
GO:0051716	0.304	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005694	0.998	chromosome
GO:0005654	0.933	nucleoplasm
GO:0005737	0.347	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]