StarFunc result for job id Q76I76

User Input

>input (1423 residues)
MALVTVQRSPTPSTTSSPCASEADSGEEECRSQPRSISESFLTVKGAALFLPRGNGSSTP
RISHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRYMVVVSTNGRQDTEE
SIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHLDGDGGFSVSTDNRVHIFKPVSVQAMWSA
LQSLHKACEVARAHNYYPGSLFLTWVSYYESHINSDQSSVNEWNAMQDVQSHRPDSPALF
TDIPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIV
ILGQMDSPTQIFEHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVY
DEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYD
YVKERRTVTKPNPSFMRQLEEYQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELN
KKDITTSADQIAEVKTMESHPPIPPVFVEHMVPQDANQKGLCTKERMICLEFTSREFHAG
QIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETD
ALKADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFV
ELSQETRSRSFSHSRMEELGGGRNESCRLSVVEVAPSKVTADDQRSSSLSNTPHASEESS
MDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTP
KKNSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEE
GEPAEGEQELQGSGMHPGAKWYPGSVRRATLEFEERLRQEQEHHGAAPTCTSLSTRKNSK
NDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVL
EFDHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIEYTHIVTS
PNHTGPGSEIATSEKSGEQGLRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPH
SSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHL
EGFTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPYKDSQLSSADLSLISKLGDNTGELQ
EKMDPLPVACRLPHSSSSENIKSLSHSPGVVKERAKEIESRVVFQAGLTKPSQMRRSASL
AKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPT
KSFVEQLTTTECIVQSKPVERPLVQYAKEFGSSQQYLLPRAGLELTSSEGGLPVLQTQGL
QCACPAPGLAVAPRQQHGRTHPLRRLKKANDKKRTTNPFYNTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q76I76	0.999	0.999	0.000	1423	1.000	1.000	Q76I76.pdb.gz	SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1
2	AFDB:Q8WYL5	0.292	0.384	3.898E-65	1049	0.302	0.410	Q8WYL5.pdb.gz	SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens OX=9606 GN=SSH1 PE=1 SV=2
3	AFDB:Q8TE77	0.271	0.548	4.510E-50	659	0.171	0.369	Q8TE77.pdb.gz	SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3 PE=1 SV=2
4	PDB:6d66A	0.106	0.286	2.440E-14	517	0.037	0.101	6d66A.pdb.gz
5	PDB:2wgpA	0.101	0.831	1.079E-12	168	0.039	0.333	2wgpA.pdb.gz
6	PDB:2esbA	0.100	0.855	4.470E-12	162	0.027	0.235	2esbA.pdb.gz
7	PDB:5y15A	0.097	0.893	4.966E-12	148	0.038	0.365	5y15A.pdb.gz
8	PDB:2y96A	0.100	0.770	3.768E-9	175	0.032	0.257	2y96A.pdb.gz
9	PDB:2gwoC	0.099	0.770	5.447E-9	174	0.031	0.253	2gwoC.pdb.gz
10	PDB:3f81A	0.098	0.737	8.747E-9	179	0.028	0.223	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
11	PDB:2q05A	0.089	0.625	1.405E-8	181	0.031	0.243	2q05A.pdb.gz
12	PDB:5xjvB	0.095	0.742	2.642E-8	171	0.030	0.251	5xjvB.pdb.gz
13	PDB:4ercA	0.095	0.820	3.720E-6	150	0.015	0.147	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
14	AFDB:O60885	0.043	0.044	1.733E-3	1362	0.110	0.115	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
15	AFDB:Q921C3	0.047	0.034	1.926E-3	2304	0.137	0.085	Q921C3.pdb.gz	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
16	AFDB:Q9ESU6	0.040	0.041	5.816E-3	1400	0.112	0.114	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
17	AFDB:A8JNM1	0.039	0.035	8.860E-3	1717	0.110	0.091	A8JNM1.pdb.gz	A8JNM1_DROME Formin 3, isoform B OS=Drosophila melanogaster OX=7227 GN=form3 PE=4 SV=1
18	AFDB:Q80XP9	0.052	0.046	1.038E-2	1757	0.165	0.134	Q80XP9.pdb.gz	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
19	AFDB:F1MAK3	0.049	0.043	1.215E-2	2101	0.153	0.104	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
20	AFDB:Q5ALV2	0.063	0.070	1.581E-2	1257	0.084	0.095	Q5ALV2.pdb.gz	SLA1_CANAL Actin cytoskeleton-regulatory complex protein SLA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLA1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A2G7	0.0	671	997	0.216	0.308	A0A8I6A2G7_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=3 SV=1
2	A0A8I6AIB0	0.0	645	1018	0.219	0.306	A0A8I6AIB0_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=3 SV=1
3	A0A8I6APG2	0.0	2186	1422	0.779	0.779	A0A8I6APG2_RAT Slingshot protein phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=1
4	A0A8I6ATT8	0.0	2304	1423	0.820	0.820	A0A8I6ATT8_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=1
5	A0A8I6B0P9	0.0	691	1053	0.232	0.313	A0A8I6B0P9_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=3 SV=1
6	F1LWM1	0.0	683	1032	0.221	0.304	F1LWM1_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=1 SV=3
7	F1M4Q5	0.0	2253	1430	0.795	0.791	F1M4Q5_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=2
8	Q76I76	0.0	2951	1423	1.000	1.000	SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1
9	Q8WYL5	0.0	701	1049	0.234	0.317	SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens OX=9606 GN=SSH1 PE=1 SV=2
10	Q8TE77	4.24e-134	430	659	0.152	0.329	SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3 PE=1 SV=2
11	Q6NN85	1.22e-133	441	1045	0.148	0.201	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2
12	Q05922	1.06e-27	117	318	0.037	0.167	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
13	Q91790	1.46e-26	115	369	0.037	0.141	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
14	Q05923	7.40e-26	112	314	0.039	0.178	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
15	P28563	7.64e-26	113	367	0.036	0.139	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
16	Q64623	8.55e-26	113	367	0.036	0.139	DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1
17	P28562	1.14e-25	112	367	0.036	0.139	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
18	Q9ZR37	8.06e-25	105	198	0.039	0.283	DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=DSPTP1 PE=1 SV=1
19	Q99956	2.15e-24	109	384	0.038	0.141	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
20	Q7SZF3	2.54e-24	108	367	0.037	0.142	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08766 DEK_C	9.6e-08	43.2	DEK C terminal domain
2	PF00782 DSPc	3.7e-30	115.9	Dual specificity phosphatase, catalytic domain
3	PF00102 Y_phosphatase	1.2e+02	13.7	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444743

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432660	0.958	Cofilin-1
2	9606.ENSP00000336740	0.913	LIM domain kinase 1
3	9606.ENSP00000298159	0.884	Cofilin-2
4	9606.ENSP00000315713	0.825	Protein phosphatase Slingshot homolog 1
5	9606.ENSP00000312081	0.822	Protein phosphatase Slingshot homolog 3
6	9606.ENSP00000328340	0.764	E3 ubiquitin-protein ligase RNF135
7	9606.ENSP00000361158	0.735	Dual specificity testis-specific protein kinase 2
8	9606.ENSP00000378323	0.732	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
9	9606.ENSP00000378306	0.725	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
10	9606.ENSP00000339916	0.712	LIM domain kinase 2
11	9606.ENSP00000380878	0.707	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
12	9606.ENSP00000246069	0.663	Destrin
13	9606.ENSP00000363939	0.655	Calcineurin subunit B type 2
14	9606.ENSP00000234310	0.652	Calcineurin subunit B type 1
15	9606.ENSP00000333779	0.651	Protein EVI2B
16	9606.ENSP00000386229	0.612	Regulator of G-protein signaling 14
17	9606.ENSP00000247270	0.608	Protein EVI2A
18	9606.ENSP00000215904	0.607	Pyridoxal phosphate phosphatase
19	9606.ENSP00000478783	0.597	E3 ubiquitin-protein ligase listerin
20	9606.ENSP00000358866	0.583	Filamin-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0004721	1.000	phosphoprotein phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.960	regulation of biological process
GO:0009987	0.945	cellular process
GO:0050794	0.933	regulation of cellular process
GO:0071840	0.905	cellular component organization or biogenesis
GO:0071704	0.859	organic substance metabolic process
GO:0016043	0.849	cellular component organization
GO:0044238	0.831	primary metabolic process
GO:0030029	0.824	actin filament-based process
GO:0044237	0.820	cellular metabolic process
GO:0006807	0.784	nitrogen compound metabolic process
GO:0043170	0.783	macromolecule metabolic process
GO:0016311	0.777	dephosphorylation
GO:0006996	0.746	organelle organization
GO:0043412	0.726	macromolecule modification
GO:1901564	0.721	organonitrogen compound metabolic process
GO:0019538	0.708	protein metabolic process
GO:0048518	0.707	positive regulation of biological process
GO:0030036	0.696	actin cytoskeleton organization
GO:0006470	0.693	protein dephosphorylation
GO:0048522	0.672	positive regulation of cellular process
GO:2000145	0.434	regulation of cell motility
GO:0030334	0.415	regulation of cell migration
GO:0030335	0.356	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005576	0.994	extracellular region
GO:0005615	0.974	extracellular space
GO:0005737	0.957	cytoplasm
GO:0005829	0.912	cytosol
GO:0043226	0.797	organelle
GO:0043229	0.738	intracellular organelle
GO:0043227	0.619	membrane-bounded organelle
GO:0043231	0.383	intracellular membrane-bounded organelle
GO:0043232	0.369	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]