StarFunc result for job id Q76KP1

User Input

>input (1039 residues)
MPRLPVKKIRKQMKLLLLLLLLSCAAWLTYVHLGLVRQGRALRQRLGYGRDGEKLTSETD
GRGVHAAPSTQRAEDSSESREEEQAPEGRDLDMLFPGGAGRLPLNFTHQTPPWREEYKGQ
VNLHVFEDWCGGAVGHLRRNLHFPLFPHTRTTVKKLAVSPKWKNYGLRIFGFIHPARDGD
VQFSVASDDNSEFWLSLDESPAAAQLVAFVGKTGSEWTAPGEFTKFSSQVSKPRRLMASR
RYYFELLHKQDDRGSDHVEVGWRAFLPGLKFEVISSAHISLYTDESALKMDHVAHVPQSP
ASHVGGRPPQEETSADMLRPDPRDTFFLTPRMESSSLENVLEPCAYAPTYVVKDFPIARY
QGLQFVYLSFVYPNDYTRLTHMETDNKCFYRESPLYLERFGFYKYMKMDKEEGDEDEEDE
VQRRAFLFLNPDDFLDDEDEGELLDSLEPTEAAPPRSGPQSPAPAAPAQPGATLAPPTPP
RPRDGGTPRHSRALSWAARAARPLPLFLGRAPPPRPAVEQPPPKVYVTRVRPGQRASPRA
PAPRAPWPPFPGVFLHPRPLPRVQLRAPPRPPRPHGRRTGGPQATQPRPPARAQATQGGR
EGQARTLGPAAPTVDSNLSSEARPVTSFLSLSQVSGPQLPGEGEEEEEGEDDGAPGDEAA
SEDSEEAAGPALGRWREDAIDWQRTFSVGAVDFELLRSDWNDLRCNVSGNLQLPEAEAVD
VTAQYMERLNARHGGRFALLRIVNVEKRRDSARGSRFLLELELQERGGGRLRLSEYVFLR
LPGARVGDADGESPEPAPAASVRPDGRPELCRPLRLAWRQDVMVHFIVPVKNQARWVAQF
LADMAALHARTGDSRFSVVLVDFESEDMDVERALRAARLPRYQYLRRTGNFERSAGLQAG
VDAVEDASSIVFLCDLHIHFPPNILDGIRKHCVEGRLAFAPVVMRLSCGSSPRDPHGYWE
VNGFGLFGIYKSDFDRVGGMNTEEFRDQWGGEDWELLDRVLQAGLEVERLRLRNFYHHYH
SKRGMWSVRSRKGSRTGAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q76KP1	1.000	1.000	0.000	1039	1.000	1.000	Q76KP1.pdb.gz	B4GN4_HUMAN N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALNT4 PE=1 SV=1
2	AFDB:Q6L9W6	0.615	0.640	5.830E-104	998	0.447	0.465	Q6L9W6.pdb.gz	B4GN3_HUMAN Beta-1,4-N-acetylgalactosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALNT3 PE=1 SV=2
3	AFDB:Q6FX55	0.129	0.180	3.291E-7	715	0.070	0.102	Q6FX55.pdb.gz	Q6FX55_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA6 PE=1 SV=1
4	PDB:4d0tA	0.158	0.313	1.600E-6	496	0.043	0.091	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
5	AFDB:Q6FUW5	0.120	0.121	5.113E-6	1034	0.061	0.061	Q6FUW5.pdb.gz	Q6FUW5_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA1 PE=1 SV=1
6	PDB:4d11C	0.156	0.346	6.306E-6	436	0.047	0.112	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
7	PDB:6pxuB	0.158	0.295	7.435E-6	532	0.042	0.083	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
8	PDB:2d7iA	0.162	0.299	1.033E-5	536	0.038	0.075	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
9	PDB:6h0bB	0.157	0.298	1.033E-5	521	0.042	0.084	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
10	PDB:4h2aA	0.110	0.157	1.996E-5	704	0.026	0.038	4h2aA.pdb.gz	Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
11	PDB:1t6bX	0.107	0.160	2.227E-5	676	0.030	0.046	1t6bX.pdb.gz	Crystal structure of a complex between anthrax toxin and its host cell receptor
12	PDB:5mlzA	0.130	0.333	7.446E-5	355	0.036	0.104	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
13	PDB:6iwqA	0.145	0.264	9.797E-5	546	0.034	0.064	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
14	PDB:5jovA	0.097	0.105	1.362E-4	949	0.018	0.020	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
15	AFDB:Q9GPJ1	0.059	0.046	1.236E-2	1503	0.105	0.073	Q9GPJ1.pdb.gz	SKEL2_DROME Protein Skeletor, isoforms D/E OS=Drosophila melanogaster OX=7227 GN=Skel PE=1 SV=3
16	AFDB:Q9JIS1	0.058	0.043	1.379E-2	1555	0.104	0.069	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
17	AFDB:Q3TUF7	0.043	0.036	2.814E-2	1407	0.105	0.077	Q3TUF7.pdb.gz	YETS2_MOUSE YEATS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Yeats2 PE=1 SV=2
18	AFDB:P14738	0.073	0.074	4.132E-2	1018	0.064	0.066	P14738.pdb.gz	FNBA_STAA8 Fibronectin-binding protein A OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=fnbA PE=1 SV=1
19	AFDB:Q99NE5	0.061	0.047	4.132E-2	1463	0.102	0.072	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
20	AFDB:Q9P2P5	0.045	0.034	7.981E-2	1572	0.097	0.064	Q9P2P5.pdb.gz	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76KP1	0.0	2106	1039	1.000	1.000	B4GN4_HUMAN N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALNT4 PE=1 SV=1
2	Q6L9W6	2.42e-136	438	998	0.208	0.216	B4GN3_HUMAN Beta-1,4-N-acetylgalactosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALNT3 PE=1 SV=2
3	E9PHD9	1.98e-128	406	636	0.179	0.292	E9PHD9_HUMAN Beta-1,4-N-acetyl-galactosaminyltransferase 3 (Fragment) OS=Homo sapiens OX=9606 GN=B4GALNT3 PE=1 SV=8
4	Q8TDX6	1.29e-18	93.2	532	0.056	0.109	CGAT1_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=CSGALNACT1 PE=1 SV=2
5	Q8BJQ9	1.07e-17	90.1	530	0.055	0.108	CGAT1_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Csgalnact1 PE=2 SV=1
6	A1Z863	2.97e-15	82.4	540	0.058	0.111	A1Z863_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=Csgalnact PE=2 SV=1
7	E7F6G2	3.70e-15	82.4	580	0.055	0.098	E7F6G2_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=csgalnact1a PE=3 SV=1
8	Q8N6G5	8.58e-15	80.9	542	0.056	0.107	CGAT2_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=CSGALNACT2 PE=1 SV=1
9	Q8C1F4	6.23e-14	78.2	542	0.057	0.109	CGAT2_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=Csgalnact2 PE=2 SV=1
10	Q86X52	9.43e-14	78.2	802	0.052	0.067	CHSS1_HUMAN Chondroitin sulfate synthase 1 OS=Homo sapiens OX=9606 GN=CHSY1 PE=1 SV=3
11	Q6ZQ11	1.74e-13	77.4	800	0.045	0.059	CHSS1_MOUSE Chondroitin sulfate synthase 1 OS=Mus musculus OX=10090 GN=Chsy1 PE=2 SV=2
12	D3ZRM3	6.95e-13	75.5	799	0.050	0.065	D3ZRM3_RAT Hexosyltransferase OS=Rattus norvegicus OX=10116 GN=Chsy1 PE=3 SV=3
13	Q6P296	2.06e-11	70.5	801	0.083	0.107	Q6P296_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=chys1 PE=2 SV=1
14	Q7Z1Z1	1.49e-10	67.8	736	0.058	0.082	CHSSA_CAEEL Chondroitin sulfate synthase sqv-5 OS=Caenorhabditis elegans OX=6239 GN=sqv-5 PE=1 SV=1
15	Q70JA7	2.27e-09	63.9	882	0.046	0.054	CHSS3_HUMAN Chondroitin sulfate synthase 3 OS=Homo sapiens OX=9606 GN=CHSY3 PE=2 SV=3
16	Q5DTK1	4.38e-09	63.2	884	0.088	0.103	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
17	M9PC48	0.005	43.5	18095	0.046	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PCJ6	0.005	43.5	18641	0.046	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PB30	0.019	41.6	22949	0.038	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
20	M9PBZ0	0.019	41.6	22830	0.038	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05679 CHGN	4.6e-21	86.8	Chondroitin N-acetylgalactosaminyltransferase
2	PF00535 Glycos_transf_2	0.053	24.8	Glycosyl transferase family 2
3	PF10111 Glyco_tranf_2_2	9e+02	10.7	Glycosyltransferase like family 2
4	PF02709 Glyco_transf_7C	1.1e-11	55.6	N-terminal domain of galactosyltransferase
5	PF07691 PA14	9.1	17.5	PA14 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328277

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262622	0.920	Carbohydrate sulfotransferase 8
2	9606.ENSP00000310696	0.910	Beta-1,4-galactosyltransferase 2
3	9606.ENSP00000480428	0.906	Beta-1,4-galactosyltransferase 3
4	9606.ENSP00000480991	0.906	Carbohydrate sulfotransferase 9
5	9606.ENSP00000353910	0.904	Alpha-(1,6)-fucosyltransferase
6	9606.ENSP00000369055	0.903	Beta-1,4-galactosyltransferase 1
7	9606.ENSP00000387185	0.853	Protein-glucosylgalactosylhydroxylysine glucosidase
8	9606.ENSP00000266383	0.816	Beta-1,4-N-acetylgalactosaminyltransferase 3
9	9606.ENSP00000341562	0.709	Beta-1,4 N-acetylgalactosaminyltransferase 1
10	9606.ENSP00000355559	0.671	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2
11	9606.ENSP00000329548	0.614	Tumor suppressor candidate 5
12	9606.ENSP00000390784	0.611	Beta-1,3-galactosyltransferase 4
13	9606.ENSP00000372059	0.608	Interferon-induced transmembrane protein 5
14	9606.ENSP00000331474	0.564	Synapse differentiation-inducing gene protein 1-like
15	9606.ENSP00000300404	0.553	Beta-1,4 N-acetylgalactosaminyltransferase 2
16	9606.ENSP00000344430	0.541	Interferon induced transmembrane protein 10
17	9606.ENSP00000221922	0.502	Coiled-coil domain containing 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008376	1.000	acetylgalactosaminyltransferase activity
GO:0005488	0.673	binding
GO:0005515	0.367	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0044238	0.992	primary metabolic process
GO:0009987	0.987	cellular process
GO:0044237	0.981	cellular metabolic process
GO:0019538	0.971	protein metabolic process
GO:0009058	0.905	biosynthetic process
GO:1901576	0.896	organic substance biosynthetic process
GO:0044249	0.893	cellular biosynthetic process
GO:1901135	0.886	carbohydrate derivative metabolic process
GO:1901137	0.822	carbohydrate derivative biosynthetic process
GO:1901566	0.806	organonitrogen compound biosynthetic process
GO:0009100	0.796	glycoprotein metabolic process
GO:0009101	0.793	glycoprotein biosynthetic process
GO:0065007	0.310	biological regulation
GO:0050654	0.306	chondroitin sulfate proteoglycan metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.893	membrane
GO:0031090	0.825	organelle membrane
GO:0098588	0.803	bounding membrane of organelle
GO:0000139	0.737	Golgi membrane
GO:0071944	0.657	cell periphery
GO:0070013	0.376	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]