StarFunc result for job id Q76L83

User Input

>input (1435 residues)
MREKGRRKKGRTWAEAAKTVLEKYPNTPMSHKEILQVIQREGLKEIRSGTSPLACLNAML
HTNSRGEEGIFYKVPGRMGVYTLKKDVPDGVKELSEGSEESSDGQSDSQSSENSSSSSDG
GSNKEGKKSRWKRKVSSSSPQSGCPSPTIPAGKVISPSQKHSKKALKQALKQQQQKKQQQ
QCRPSISISSNQHLSLKTVKAASDSVPAKPATWEGKQSDGQTGSPQNSNSSFSSSVKVEN
TLLGLGKKSFQRSERLHTRQMKRTKCADIDVETPDSILVNTNLRALINKHTFSVLPGDCQ
QRLLLLLPEVDRQVGPDGLMKLNGSALNNEFFTSAAQGWKERLSEGEFTPEMQVRIRQEI
EKEKKVEPWKEQFFESYYGQSSGLSLEDSKKLTASPSDPKVKKTPAEQPKSMPVSEASLI
RIVPVVSQSECKEEALQMSSPGRKEECESQGEVQPNFSTSSEPLLSSALNTHELSSILPI
KCPKDEDLLEQKPVTSAEQESEKNHLTTASNYNKSESQESLVTSPSKPKSPGVEKPIVKP
TAGAGPQETNMKEPLATLVDQSPESLKRKSSLTQEEAPVSWEKRPRVTENRQHQQPFQVS
PQPFLNRGDRIQVRKVPPLKIPVSRISPMPFHPSQVSPRARFPVSITSPNRTGARTLADI
KAKAQLVKAQRAAAAAAAAAAAAASVGGTIPGPGPGGGQGPGEGGEGQTARGGSPGSDRV
SETGKGPTLELAGTGSRGGTRELLPCGPETQPQSETKTTPSQAQPHSVSGAQLQQTPPVP
PTPAVSGACTSVPSPAHIEKLDNEKLNPTRATATVASVSHPQGPSSCRQEKAPSPTGPAL
ISGASPVHCAADGTVELKAGPSKNIPNPSASSKTDASVPVAVTPSPLTSLLTTATLEKLP
VPQVSATTAPAGSAPPSSTLPAASSLKTPGTSLNMNGPTLRPTSSIPANNPLVTQLLQGK
DVPMEQILPKPLTKVEMKTVPLTAKEERGMGALIATNTTENSTREEVNERQSHPATQQQL
GKTLQSKQLPQVPRPLQLFSAKELRDSSIDTHQYHEGLSKATQDQILQTLIQRVRRQNLL
SVVPPSQFNFAHSGFQLEDISTSQRFMLGFAGRRTSKPAMAGHYLLNISTYGRGSESFRR
THSVNPEDRFCLSSPTEALKMGYTDCKNATGESSSSKEDDTDEESTGDEQESVTVKEEPQ
VSQSAGKGDTSSGPHSRETLSTSDCLASKNVKAEIPLNEQTTLSKENYLFTRGQTFDEKT
LARDLIQAAQKQMAHAVRGKAIRSSPELFSSTVLPLPADSPTHQPLLLPPLQTPKLYGSP
TQIGPSYRGMINVSTSSDMDHNSAVPGSQVSSNVGDVMSFSVTVTTIPASQAMNPSSHGQ
TIPVQAFSEENSIEGTPSKCYCRLKAMIMCKGCGAFCHDDCIGPSKLCVSCLVVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z8N9	0.179	0.205	0.000	1225	0.670	0.784	D3Z8N9.pdb.gz	D3Z8N9_RAT ASXL transcriptional regulator 2 OS=Rattus norvegicus OX=10116 GN=Asxl2 PE=3 SV=4
2	AFDB:Q76L83	0.999	0.999	0.000	1435	1.000	1.000	Q76L83.pdb.gz	ASXL2_HUMAN Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
3	AFDB:Q8BZ32	0.216	0.224	0.000	1370	0.770	0.807	Q8BZ32.pdb.gz	ASXL2_MOUSE Putative Polycomb group protein ASXL2 OS=Mus musculus OX=10090 GN=Asxl2 PE=1 SV=1
4	AFDB:Q8IXJ9	0.125	0.118	2.078E-38	1541	0.291	0.271	Q8IXJ9.pdb.gz	ASXL1_HUMAN Polycomb group protein ASXL1 OS=Homo sapiens OX=9606 GN=ASXL1 PE=1 SV=4
5	AFDB:P59598	0.137	0.131	1.913E-36	1514	0.289	0.274	P59598.pdb.gz	ASXL1_MOUSE Polycomb group protein ASXL1 OS=Mus musculus OX=10090 GN=Asxl1 PE=1 SV=1
6	AFDB:A0A0G2JU33	0.105	0.101	3.009E-34	1493	0.270	0.259	A0A0G2JU33.pdb.gz	A0A0G2JU33_RAT ASXL transcriptional regulator 1 OS=Rattus norvegicus OX=10116 GN=Asxl1 PE=3 SV=2
7	AFDB:Q9C0F0	0.123	0.086	1.493E-30	2248	0.263	0.168	Q9C0F0.pdb.gz	ASXL3_HUMAN Putative Polycomb group protein ASXL3 OS=Homo sapiens OX=9606 GN=ASXL3 PE=2 SV=3
8	AFDB:O15054	0.037	0.034	3.417E-4	1643	0.139	0.122	O15054.pdb.gz	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
9	AFDB:Q388G0	0.039	0.038	3.480E-3	1506	0.130	0.124	Q388G0.pdb.gz	Q388G0_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2330 PE=4 SV=1
10	AFDB:Q5VUA4	0.042	0.033	1.016E-2	2279	0.155	0.098	Q5VUA4.pdb.gz	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
11	PDB:2o03A	0.030	0.275	1.583	129	0.008	0.085	2o03A.pdb.gz	Crystal structure and function of the zinc uptake regulator FurB from Mycobacterium tuberculosis.
12	PDB:6h1cB	0.034	0.297	2.132	134	0.004	0.045	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
13	PDB:4zzlA	0.037	0.194	2.705	146	0.014	0.137	4zzlA.pdb.gz
14	PDB:7asvA	0.039	0.269	2.705	155	0.006	0.058	7asvA.pdb.gz
15	PDB:4ad9A	0.030	0.135	3.046	288	0.005	0.024	4ad9A.pdb.gz	Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
16	PDB:6zmiCE	0.035	0.526	3.046	72	0.007	0.139	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
17	PDB:7a6hP	0.034	0.205	3.046	146	0.013	0.123	7a6hP.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
18	PDB:7vo0G	0.040	0.303	3.046	131	0.009	0.099	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
19	PDB:6labV	0.038	0.344	3.642	109	0.008	0.101	6labV.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
20	PDB:6qfbC	0.028	0.037	3.865	1011	0.006	0.009	6qfbC.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F9ZHN2	0.0	1064	526	0.367	1.000	A0A5F9ZHN2_HUMAN ASXL transcriptional regulator 2 (Fragment) OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
2	D3Z8N9	0.0	1775	1297	0.702	0.776	D3Z8N9_RAT ASXL transcriptional regulator 2 OS=Rattus norvegicus OX=10116 GN=Asxl2 PE=3 SV=4
3	E7EWD6	0.0	2911	1434	0.999	1.000	E7EWD6_HUMAN ASXL transcriptional regulator 2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=2
4	Q76L83	0.0	2918	1435	1.000	1.000	ASXL2_HUMAN Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
5	Q8BZ32	0.0	1927	1370	0.766	0.802	ASXL2_MOUSE Putative Polycomb group protein ASXL2 OS=Mus musculus OX=10090 GN=Asxl2 PE=1 SV=1
6	Q9C0F0	9.93e-96	344	2248	0.140	0.089	ASXL3_HUMAN Putative Polycomb group protein ASXL3 OS=Homo sapiens OX=9606 GN=ASXL3 PE=2 SV=3
7	P59598	1.33e-81	298	1514	0.137	0.129	ASXL1_MOUSE Polycomb group protein ASXL1 OS=Mus musculus OX=10090 GN=Asxl1 PE=1 SV=1
8	A0A0G2JU33	3.48e-52	204	1448	0.067	0.066	A0A0G2JU33_RAT ASXL transcriptional regulator 1 OS=Rattus norvegicus OX=10116 GN=Asxl1 PE=3 SV=2
9	Q8IXJ9	6.36e-52	203	1541	0.067	0.062	ASXL1_HUMAN Polycomb group protein ASXL1 OS=Homo sapiens OX=9606 GN=ASXL1 PE=1 SV=4
10	Q9V727	1.01e-31	138	1669	0.080	0.069	ASX_DROME Polycomb protein Asx OS=Drosophila melanogaster OX=7227 GN=Asx PE=1 SV=1
11	Q10135	1.7	35.8	1273	0.026	0.030	LSD2_SCHPO Lysine-specific histone demethylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsd2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13919 ASXH	4.1e-31	119.3	Asx homology domain
2	PF05066 HARE-HTH	3.1e-18	77.3	HB1, ASXL, restriction endonuclease HTH domain
3	PF13922 PHD_3	2.1e-21	87.4	PHD domain of transcriptional enhancer, Asx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003827100.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003818809.1	0.983	BRCA1 associated protein 1
2	9597.XP_008976740.1	0.903	methyl-CpG binding domain protein 6
3	9597.XP_003820644.2	0.830	Ubiquitin C-terminal hydrolase L5
4	9597.XP_008971416.1	0.828	Forkhead box protein K1 isoform X1
5	9597.XP_003820179.1	0.813	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit isoform X1
6	9597.XP_008975029.1	0.779	Lysine demethylase 1B
7	9597.XP_008949138.1	0.765	Forkhead box protein K2
8	9597.XP_008959382.1	0.765	Forkhead box protein K2
9	9597.XP_008968044.1	0.761	methyl-CpG binding domain protein 5
10	9597.XP_008955909.1	0.756	SMG1, nonsense mediated mRNA decay associated PI3K related kinase
11	9597.XP_008956321.1	0.722	Histone-lysine N-methyltransferase SETD1B
12	9597.XP_008957911.1	0.722	SET domain containing 1A
13	9597.XP_008962249.1	0.721	Host cell factor 1 isoform X1
14	9597.XP_003831041.1	0.694	Homeobox protein Hox-C8
15	9597.XP_003817373.1	0.692	Belongs to the histone H2A family.
16	9597.XP_003804826.1	0.687	Belongs to the histone H2A family.
17	9597.XP_008968753.1	0.676	Belongs to the histone H2A family.
18	9597.XP_008961533.1	0.667	Zinc finger protein 462 isoform X1
19	9597.XP_008964748.1	0.664	Enhancer of zeste 1 polycomb repressive complex 2 subunit
20	9597.XP_008972207.1	0.664	Enhancer of zeste 2 polycomb repressive complex 2 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042975	1.000	peroxisome proliferator activated receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009889	0.986	regulation of biosynthetic process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0009893	0.979	positive regulation of metabolic process
GO:0006355	0.975	regulation of DNA-templated transcription
GO:0051173	0.920	positive regulation of nitrogen compound metabolic process
GO:0006357	0.917	regulation of transcription by RNA polymerase II
GO:0031325	0.911	positive regulation of cellular metabolic process
GO:0010604	0.897	positive regulation of macromolecule metabolic process
GO:1903508	0.750	positive regulation of nucleic acid-templated transcription
GO:0045893	0.730	positive regulation of DNA-templated transcription
GO:0048519	0.693	negative regulation of biological process
GO:0045944	0.648	positive regulation of transcription by RNA polymerase II
GO:0009987	0.643	cellular process
GO:0008152	0.631	metabolic process
GO:0071704	0.618	organic substance metabolic process
GO:0044238	0.617	primary metabolic process
GO:0009892	0.600	negative regulation of metabolic process
GO:0010605	0.593	negative regulation of macromolecule metabolic process
GO:0006807	0.590	nitrogen compound metabolic process
GO:0048523	0.587	negative regulation of cellular process
GO:0048583	0.569	regulation of response to stimulus
GO:0051172	0.563	negative regulation of nitrogen compound metabolic process
GO:0031324	0.563	negative regulation of cellular metabolic process
GO:0009890	0.536	negative regulation of biosynthetic process
GO:0045934	0.535	negative regulation of nucleobase-containing compound metabolic process
GO:1901564	0.528	organonitrogen compound metabolic process
GO:1902679	0.514	negative regulation of RNA biosynthetic process
GO:0045892	0.482	negative regulation of DNA-templated transcription
GO:0043170	0.478	macromolecule metabolic process
GO:0036211	0.458	protein modification process
GO:0044237	0.451	cellular metabolic process
GO:0050793	0.435	regulation of developmental process
GO:0045595	0.415	regulation of cell differentiation
GO:0044260	0.356	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.557	protein-containing complex
GO:0005737	0.337	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]