StarFunc result for job id Q76LX8

User Input

>input (1427 residues)
MHQRHPRARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLKGRP
PSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSL
GAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITR
FDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGS
GCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGHPPDAQ
PGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSCHTDPLDQSSCSRLLVPLLDGTEC
GVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPRSPCSRSCGGGVVTRRRQCNNPRPAFGG
RACVGADLQAEMCNTQACEKTQLEFMSQQCARTDGQPLRSSPGGASFYHWGAAVPHSQGD
ALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMDSQQ
VWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAVRIG
GRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPRLEEIRIWGPLQEDADIQVYRR
YGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKELVE
TVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERPVRCVEAQGSLLKTL
PPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCTSAGGAGLALENETCVPGADGLEA
PVTEGPGSVDEKLPAPEPCVGMSCPPGWGHLDATSAGEKAPSPWGSIRTGAQAAHVWTPA
AGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWQYKLA
ACSVSCGRGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWKVMS
LGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAALVRPEASVPCLIADCTYRWHVGT
WMECSVSCGDGIQRRRDTCLGPQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPSLVP
HEEAAAPGRTTATPAGASLEWSQARGLLFSPAPQPRRLLPGPQENSVQSSACGRQHLEPT
GTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRKLLDM
TFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATS
NAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWE
SESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A0T9	0.621	0.622	0.000	1425	0.691	0.692	D4A0T9.pdb.gz	D4A0T9_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 13 OS=Rattus norvegicus OX=10116 GN=Adamts13 PE=4 SV=3
2	AFDB:Q769J6	0.556	0.557	0.000	1426	0.699	0.699	Q769J6.pdb.gz	ATS13_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 13 OS=Mus musculus OX=10090 GN=Adamts13 PE=1 SV=1
3	AFDB:Q76LX8	1.000	1.000	0.000	1427	1.000	1.000	Q76LX8.pdb.gz	ATS13_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 13 OS=Homo sapiens OX=9606 GN=ADAMTS13 PE=1 SV=1
4	AFDB:F1R6Q4	0.196	0.192	1.144E-83	1461	0.231	0.226	F1R6Q4.pdb.gz
5	AFDB:Q8TE60	0.210	0.243	5.222E-82	1221	0.214	0.250	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
6	AFDB:P59510	0.199	0.155	9.362E-82	1910	0.229	0.171	P59510.pdb.gz	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
7	AFDB:Q9P2N4	0.194	0.145	1.134E-80	1935	0.228	0.168	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
8	AFDB:Q69Z28	0.199	0.231	1.664E-78	1222	0.204	0.238	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
9	AFDB:E9PUN6	0.193	0.145	2.923E-77	1931	0.224	0.165	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
10	AFDB:Q68SA9	0.199	0.172	2.151E-75	1657	0.235	0.203	Q68SA9.pdb.gz	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
11	PDB:7b01A	0.151	0.362	6.462E-32	588	0.153	0.371	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
12	PDB:1w0rA	0.051	0.117	2.802E-12	442	0.064	0.208	1w0rA.pdb.gz
13	PDB:4q1lA	0.130	0.847	9.497E-12	202	0.032	0.228	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
14	PDB:1rc6A	0.045	0.214	1.883E-3	242	0.013	0.079	1rc6A.pdb.gz
15	PDB:5a42A	0.048	0.044	2.094E-3	1597	0.067	0.060	5a42A.pdb.gz
16	PDB:7nycC	0.035	0.058	2.094E-3	809	0.027	0.047	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:3t5oA	0.048	0.070	2.329E-3	871	0.025	0.041	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
18	PDB:4a5wB	0.043	0.065	2.456E-3	871	0.018	0.029	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
19	PDB:3j4qB	0.042	0.125	4.642E-3	382	0.022	0.081	3j4qB.pdb.gz
20	PDB:3h9aA	0.044	0.222	4.896E-3	225	0.015	0.093	3h9aA.pdb.gz	Analysis of multiple crystal forms of Bacillus subtilis BacB suggests a role for a metal ion as a nucleant for crystallization

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A0T9	0.0	1945	1425	0.689	0.690	D4A0T9_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 13 OS=Rattus norvegicus OX=10116 GN=Adamts13 PE=4 SV=3
2	M0R609	0.0	1402	1020	0.498	0.697	M0R609_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 13 OS=Rattus norvegicus OX=10116 GN=Adamts13 PE=4 SV=3
3	Q769J6	0.0	1951	1426	0.701	0.702	ATS13_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 13 OS=Mus musculus OX=10090 GN=Adamts13 PE=1 SV=1
4	Q76LX8	0.0	2892	1427	1.000	1.000	ATS13_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 13 OS=Homo sapiens OX=9606 GN=ADAMTS13 PE=1 SV=1
5	Q8TE60	1.01e-109	379	1221	0.198	0.232	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
6	P59510	1.81e-109	385	1910	0.218	0.163	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
7	P59511	7.23e-107	377	1906	0.219	0.164	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
8	Q4VC17	2.96e-104	363	1219	0.199	0.233	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
9	Q9P2N4	6.68e-103	365	1935	0.222	0.164	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
10	P58397	9.47e-103	363	1594	0.168	0.151	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
11	E7FEJ5	7.72e-102	356	1244	0.200	0.230	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
12	Q811B3	3.27e-101	358	1600	0.171	0.152	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
13	Q69Z28	6.05e-101	353	1222	0.198	0.231	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
14	D3ZLL7	6.76e-101	353	1221	0.196	0.229	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
15	E9PUN6	1.05e-99	356	1931	0.214	0.158	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
16	Q19791	6.98e-96	344	2150	0.226	0.150	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
17	Q8C9W3	2.94e-95	337	1213	0.180	0.212	ATS2_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Mus musculus OX=10090 GN=Adamts2 PE=1 SV=2
18	P97857	5.84e-95	331	968	0.157	0.231	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
19	D3Z1A5	7.35e-95	334	1117	0.175	0.224	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
20	P79331	9.64e-95	335	1205	0.181	0.214	ATS2_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Bos taurus OX=9913 GN=ADAMTS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	2.2e-14	65.0	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	3.8e-76	263.9	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	5.9e-32	121.8	ADAM-TS Spacer 1
4	PF00413 Peptidase_M10	15	16.9	Matrixin
5	PF01421 Reprolysin	3.8e-06	38.6	Reprolysin (M12B) family zinc metalloprotease
6	PF13574 Reprolysin_2	18	16.7	Metallo-peptidase family M12B Reprolysin-like
7	PF13582 Reprolysin_3	0.0014	30.5	Metallo-peptidase family M12B Reprolysin-like
8	PF13583 Reprolysin_4	0.00087	30.5	Metallo-peptidase family M12B Reprolysin-like
9	PF13688 Reprolysin_5	0.37	22.5	Metallo-peptidase family M12
10	PF19030 TSP1_ADAMTS	2.5e-44	160.6	Thrombospondin type 1 domain
11	PF19035 TSP1_CCN	2.8e+02	13.2	CCN3 Nov like TSP1 domain
12	PF19028 TSP1_spondin	0.033	25.8	Spondin-like TSP1 domain
13	PF00090 TSP_1	1.3e-20	84.6	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261405	0.998	Von Willebrand factor
2	9606.ENSP00000339613	0.961	GDP-fucose protein O-fucosyltransferase 2
3	9606.ENSP00000343002	0.943	Beta-1,3-glucosyltransferase
4	9606.ENSP00000346478	0.931	ADAMTS-like protein 2
5	9606.ENSP00000260356	0.929	Thrombospondin-1
6	9606.ENSP00000270328	0.929	A disintegrin and metalloproteinase with thrombospondin motifs 10
7	9606.ENSP00000460236	0.929	Spondin-1
8	9606.ENSP00000247153	0.927	Properdin
9	9606.ENSP00000373472	0.925	A disintegrin and metalloproteinase with thrombospondin motifs 7
10	9606.ENSP00000251582	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 2
11	9606.ENSP00000299164	0.924	ADAM metallopeptidase with thrombospondin type 1 motif 15
12	9606.ENSP00000362304	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 14
13	9606.ENSP00000369921	0.924	ADAMTS-like protein 1
14	9606.ENSP00000418735	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 9
15	9606.ENSP00000374071	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 20
16	9606.ENSP00000422554	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 12
17	9606.ENSP00000268070	0.921	ADAM metallopeptidase with thrombospondin type 1 motif 17
18	9606.ENSP00000257359	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 8
19	9606.ENSP00000274181	0.920	ADAM metallopeptidase with thrombospondin type 1 motif 16
20	9606.ENSP00000274487	0.920	ADAM metallopeptidase with thrombospondin type 1 motif 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008233	1.000	peptidase activity
GO:0005515	0.999	protein binding
GO:0004175	0.990	endopeptidase activity
GO:0008237	0.987	metallopeptidase activity
GO:0043167	0.701	ion binding
GO:0005102	0.698	signaling receptor binding
GO:0050839	0.670	cell adhesion molecule binding
GO:0046872	0.649	metal ion binding
GO:0044877	0.642	protein-containing complex binding
GO:0005509	0.630	calcium ion binding
GO:0005178	0.628	integrin binding
GO:0008270	0.618	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:0009987	0.985	cellular process
GO:0044238	0.959	primary metabolic process
GO:0019538	0.941	protein metabolic process
GO:0006508	0.886	proteolysis
GO:0051604	0.780	protein maturation
GO:0050896	0.707	response to stimulus
GO:0065007	0.612	biological regulation
GO:0050789	0.599	regulation of biological process
GO:0044237	0.463	cellular metabolic process
GO:0043603	0.460	amide metabolic process
GO:1901565	0.459	organonitrogen compound catabolic process
GO:0006518	0.408	peptide metabolic process
GO:0006950	0.401	response to stress
GO:0050794	0.339	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0012505	0.993	endomembrane system
GO:0005576	0.983	extracellular region
GO:0071944	0.980	cell periphery
GO:0005737	0.967	cytoplasm
GO:0031012	0.887	extracellular matrix
GO:0005615	0.862	extracellular space
GO:0005783	0.862	endoplasmic reticulum
GO:0005788	0.839	endoplasmic reticulum lumen
GO:0062023	0.661	collagen-containing extracellular matrix
GO:0005654	0.301	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]