StarFunc result for job id Q76M96

User Input

>input (950 residues)
MTWRMGPRFTMLLAMWLVCGSEPHPHATIRGSHGGRKVPLVSPDSSRPARFLRHTGRSRG
IERSTLEEPNLQPLQRRRSVPVLRLARPTEPPARSDINGAAVRPEQRPAARGSPREMIRD
EGSSARSRMLRFPSGSSSPNILASFAGKNRVWVISAPHASEGYYRLMMSLLKDDVYCELA
ERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMVLLKK
TLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGGG
AGRPSLGSEKKKEDPRRAQVPPTRESRVKVLRKLAATAPALPQPPSTPRATTLPPAPATT
VTRSTSRAVTVAARPMTTTAFPTTQRPWTPSPSHRPPTTTEVITARRPSVSENLYPPSRK
DQHRERPQTTRRPSKATSLESFTNAPPTTISEPSTRAAGPGRFRDNRMDRREHGHRDPNV
VPGPPKPAKEKPPKKKAQDKILSNEYEEKYDLSRPTASQLEDELQVGNVPLKKAKESKKH
EKLEKPEKEKKKKMKNENADKLLKSEKQMKKSEKKSKQEKEKSKKKKGGKTEQDGYQKPT
NKHFTQSPKKSVADLLGSFEGKRRLLLITAPKAENNMYVQQRDEYLESFCKMATRKISVI
TIFGPVNNSTMKIDHFQLDNEKPMRVVDDEDLVDQRLISELRKEYGMTYNDFFMVLTDVD
LRVKQYYEVPITMKSVFDLIDTFQSRIKDMEKQKKEGIVCKEDKKQSLENFLSRFRWRRR
LLVISAPNDEDWAYSQQLSALSGQACNFGLRHITILKLLGVGEEVGGVLELFPINGSSVV
EREDVPAHLVKDIRNYFQVSPEYFSMLLVGKDGNVKSWYPSPMWSMVIVYDLIDSMQLRR
QEMAIQQSLGMRCPEDEYAGYGYHSYHQGYQDGYQDDYRHHESYHHGYPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R2G6	0.544	0.545	0.000	949	0.839	0.840	Q8R2G6.pdb.gz	CCD80_MOUSE Coiled-coil domain-containing protein 80 OS=Mus musculus OX=10090 GN=Ccdc80 PE=1 SV=2
2	AFDB:G4SNP7	0.056	0.047	2.384E-4	1427	0.123	0.082	G4SNP7.pdb.gz	G4SNP7_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=3
3	AFDB:A0A1D8PRW9	0.052	0.046	1.450E-3	1172	0.107	0.087	A0A1D8PRW9.pdb.gz	A0A1D8PRW9_CANAL Boi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BOI2 PE=4 SV=1
4	PDB:5gu6A	0.086	0.196	7.519E-3	377	0.023	0.058	5gu6A.pdb.gz
5	AFDB:P38041	0.056	0.055	8.813E-3	980	0.144	0.140	P38041.pdb.gz	BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOI1 PE=1 SV=1
6	PDB:2p31A	0.089	0.436	9.968E-3	155	0.026	0.161	2p31A.pdb.gz
7	PDB:3cmiA	0.092	0.501	1.181E-2	143	0.025	0.168	3cmiA.pdb.gz
8	PDB:4k1fA	0.099	0.405	1.479E-2	198	0.025	0.121	4k1fA.pdb.gz
9	PDB:2c0dB	0.091	0.389	1.565E-2	175	0.026	0.143	2c0dB.pdb.gz
10	PDB:3apoA	0.082	0.109	1.656E-2	688	0.017	0.023	3apoA.pdb.gz
11	PDB:6yt3B	0.086	0.198	1.752E-2	376	0.021	0.053	6yt3B.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
12	AFDB:B8JIA4	0.046	0.034	2.574E-2	1461	0.096	0.062	B8JIA4.pdb.gz	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
13	AFDB:Q59DP0	0.053	0.063	3.225E-2	680	0.087	0.122	Q59DP0.pdb.gz	Q59DP0_DROME Shaven, isoform D OS=Drosophila melanogaster OX=7227 GN=sv PE=4 SV=1
14	AFDB:Q03213	0.051	0.049	3.610E-2	719	0.078	0.103	Q03213.pdb.gz	HOT1_YEAST High-osmolarity-induced transcription protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOT1 PE=1 SV=1
15	PDB:2r2jA	0.085	0.220	4.084E-2	328	0.024	0.070	2r2jA.pdb.gz
16	PDB:2f8aA	0.089	0.384	4.321E-2	186	0.026	0.134	2f8aA.pdb.gz
17	PDB:5xbsA	0.081	0.278	4.836E-2	246	0.019	0.073	5xbsA.pdb.gz
18	AFDB:A1Z9N7	0.048	0.037	5.064E-2	1327	0.091	0.065	A1Z9N7.pdb.gz	A1Z9N7_DROME I[[h]] channel, isoform E OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
19	AFDB:Q9S9P0	0.042	0.041	6.346E-2	990	0.087	0.084	Q9S9P0.pdb.gz	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
20	AFDB:Q386B7	0.049	0.060	7.952E-2	729	0.089	0.117	Q386B7.pdb.gz	Q386B7_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1470 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R2G6	0.0	1448	949	0.840	0.841	CCD80_MOUSE Coiled-coil domain-containing protein 80 OS=Mus musculus OX=10090 GN=Ccdc80 PE=1 SV=2
2	Q90X49	0.0	567	867	0.311	0.340	CCD80_DANRE Coiled-coil domain-containing protein 80 OS=Danio rerio OX=7955 GN=ccdc80 PE=2 SV=1
3	E7FD69	1.77e-154	479	852	0.257	0.286	E7FD69_DANRE Coiled-coil domain-containing 80-like 1 OS=Danio rerio OX=7955 GN=ccdc80l1 PE=4 SV=1
4	A0A8I6AL59	4.85e-11	68.2	380	0.048	0.121	A0A8I6AL59_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
5	B5DF94	6.12e-11	68.2	466	0.045	0.092	SRPX2_RAT Sushi repeat-containing protein SRPX2 OS=Rattus norvegicus OX=10116 GN=Srpx2 PE=1 SV=1
6	Q8R054	7.20e-11	68.2	468	0.045	0.092	SRPX2_MOUSE Sushi repeat-containing protein SRPX2 OS=Mus musculus OX=10090 GN=Srpx2 PE=1 SV=2
7	O60687	8.80e-11	67.8	465	0.043	0.088	SRPX2_HUMAN Sushi repeat-containing protein SRPX2 OS=Homo sapiens OX=9606 GN=SRPX2 PE=1 SV=1
8	P78539	7.17e-10	64.7	464	0.048	0.099	SRPX_HUMAN Sushi repeat-containing protein SRPX OS=Homo sapiens OX=9606 GN=SRPX PE=1 SV=1
9	A0A8I6ALI3	8.04e-10	64.7	504	0.048	0.091	A0A8I6ALI3_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
10	Q9R0M3	1.04e-09	64.3	464	0.048	0.099	SRPX_MOUSE Sushi-repeat-containing protein SRPX OS=Mus musculus OX=10090 GN=Srpx PE=2 SV=1
11	A0A8I6AAL5	0.001	45.1	441	0.038	0.082	A0A8I6AAL5_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
12	Q9HC84	0.018	41.6	5762	0.032	0.005	MUC5B_HUMAN Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3
13	Q8IDX6	0.020	41.6	3130	0.031	0.009	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
14	P97868	0.057	40.0	1790	0.043	0.023	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
15	Q99102	0.084	39.3	5412	0.051	0.009	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
16	P48681	0.15	38.5	1621	0.056	0.033	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
17	Q10925	1.9	34.7	1237	0.065	0.050	SID3_CAEEL Tyrosine-protein kinase sid-3 OS=Caenorhabditis elegans OX=6239 GN=sid-3 PE=1 SV=2
18	Q10172	2.4	34.7	1794	0.019	0.010	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
19	Q8I5T5	2.5	34.7	2961	0.021	0.007	Q8I5T5_PLAF7 Lysine-specific histone demethylase 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211600 PE=4 SV=1
20	C0H5F4	9.8	32.7	3254	0.020	0.006	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13778 DUF4174	1.6e-103	353.0	Domain of unknown function (DUF4174)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000206423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359682	0.909	Bombesin receptor subtype-3
2	9606.ENSP00000469591	0.723	Zinc finger protein 628
3	9606.ENSP00000412886	0.683	Calmodulin-binding transcription activator 2
4	9606.ENSP00000442973	0.625	Death-associated protein kinase 3
5	9606.ENSP00000261891	0.608	Death-associated protein kinase 2
6	9606.ENSP00000297268	0.603	Collagen alpha-2(I) chain
7	9606.ENSP00000304408	0.584	Collagen alpha-1(III) chain
8	9606.ENSP00000375919	0.568	Protein Smaug homolog 1
9	9606.ENSP00000463092	0.530	Beta-microseminoprotein
10	9606.ENSP00000346839	0.524	Fibronectin type III domain containing
11	9606.ENSP00000353988	0.517	Olfactory receptor 10A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001968	1.000	fibronectin binding
GO:0008201	1.000	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.949	response to stimulus
GO:0048522	0.949	positive regulation of cellular process
GO:0043062	0.947	extracellular structure organization
GO:0045229	0.941	external encapsulating structure organization
GO:0010810	0.931	regulation of cell-substrate adhesion
GO:0030198	0.862	extracellular matrix organization
GO:0045785	0.814	positive regulation of cell adhesion
GO:0010811	0.799	positive regulation of cell-substrate adhesion
GO:0009605	0.748	response to external stimulus
GO:0048856	0.568	anatomical structure development
GO:0032501	0.527	multicellular organismal process
GO:0007275	0.415	multicellular organism development
GO:0009653	0.357	anatomical structure morphogenesis
GO:0044419	0.327	biological process involved in interspecies interaction between organisms
GO:0009607	0.317	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005614	0.995	interstitial matrix
GO:0005604	0.985	basement membrane
GO:0005576	0.912	extracellular region
GO:0005622	0.801	intracellular anatomical structure
GO:0005737	0.727	cytoplasm
GO:0043226	0.695	organelle
GO:0043227	0.668	membrane-bounded organelle
GO:0043231	0.410	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]