StarFunc result for job id Q76MJ5

User Input

>input (926 residues)
MASAVRGSRPWPRLGLQLQFAALLLGTLSPQVHTLRPENLLLVSTLDGSLHALSKQTGDL
KWTLRDDPVIEGPMYVTEMAFLSDPADGSLYILGTQKQQGLMKLPFTIPELVHASPCRSS
DGVFYTGRKQDAWFVVDPESGETQMTLTTEGPSTPRLYIGRTQYTVTMHDPRAPALRWNT
TYRRYSAPPMDGSPGKYMSHLASCGMGLLLTVDPGSGTVLWTQDLGVPVMGVYTWHQDGL
RQLPHLTLARDTLHFLALRWGHIRLPASGPRDTATLFSTLDTQLLMTLYVGKDETGFYVS
KALVHTGVALVPRGLTLAPADGPTTDEVTLQVSGEREGSPSTAVRYPSGSVALPSQWLLI
GHHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEK
TPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQ
SLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVVGKISFNPKDVLGRGAGGTFVFRGQF
EGRAVAVKRLLRECFGLVRREVQLLQESDRHPNVLRYFCTERGPQFHYIALELCRASLQE
YVENPDLDRGGLEPEVVLQQLMSGLAHLHSLHIVHRDLKPGNILITGPDSQGLGRVVLSD
FGLCKKLPAGRCSFSLHSGIPGTEGWMAPELLQLLPPDSPTSAVDIFSAGCVFYYVLSGG
SHPFGDSLYRQANILTGAPCLAHLEEEVHDKVVARDLVGAMLSPLPQPRPSAPQVLAHPF
FWSRAKQLQFFQDVSDWLEKESEQEPLVRALEAGGCAVVRDNWHEHISMPLQTDLRKFRS
YKGTSVRDLLRAVRNKKHHYRELPVEVRQALGQVPDGFVQYFTNRFPRLLLHTHRAMRSC
ASESLFLPYYPPDSEARRPCPGATGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q76MJ5	1.000	1.000	0.000	926	1.000	1.000	Q76MJ5.pdb.gz	ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens OX=9606 GN=ERN2 PE=1 SV=4
2	AFDB:F1QYL2	0.449	0.404	1.119E-93	1031	0.498	0.447	F1QYL2.pdb.gz
3	AFDB:A0A0G2K2H4	0.446	0.424	1.953E-88	977	0.503	0.477	A0A0G2K2H4.pdb.gz	A0A0G2K2H4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=2 SV=1
4	AFDB:Q09499	0.431	0.413	7.932E-80	967	0.387	0.370	Q09499.pdb.gz	IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans OX=6239 GN=ire-1 PE=1 SV=2
5	AFDB:A8JR46	0.424	0.366	3.893E-73	1074	0.370	0.319	A8JR46.pdb.gz	A8JR46_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Ire1 PE=4 SV=1
6	AFDB:Q4WKP8	0.417	0.333	5.803E-57	1165	0.303	0.241	Q4WKP8.pdb.gz	IREA_ASPFU Serine/threonine-protein kinase/endoribonuclease ireA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ireA PE=1 SV=1
7	AFDB:Q6FUI3	0.427	0.384	1.986E-55	1036	0.266	0.237	Q6FUI3.pdb.gz	Q6FUI3_CANGA non-specific serine/threonine protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IRE1 PE=4 SV=1
8	AFDB:O94537	0.429	0.374	6.794E-54	1072	0.285	0.246	O94537.pdb.gz	IRE1_SCHPO Sensor for unfolded proteins in the ER ire1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ire1 PE=1 SV=1
9	AFDB:P32361	0.413	0.345	2.100E-53	1115	0.278	0.230	P32361.pdb.gz	IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRE1 PE=1 SV=2
10	AFDB:F4KH40	0.416	0.434	7.312E-47	887	0.251	0.262	F4KH40.pdb.gz	F4KH40_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=IRE1-1 PE=1 SV=1
11	PDB:4oauC	0.328	0.430	1.717E-16	692	0.097	0.130	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
12	PDB:1unlA	0.229	0.667	1.562E-15	292	0.086	0.274	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
13	PDB:5u6yA	0.240	0.471	2.096E-15	459	0.078	0.157	5u6yA.pdb.gz
14	PDB:4eomC	0.251	0.782	5.070E-15	276	0.090	0.301	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
15	PDB:4krcA	0.239	0.702	1.168E-14	297	0.081	0.253	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:2yaaA	0.241	0.706	3.981E-14	300	0.071	0.220	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
17	PDB:4rerA	0.250	0.485	4.181E-14	459	0.097	0.196	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:4zhxA	0.245	0.531	6.191E-14	409	0.079	0.178	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:4rgjA	0.223	0.426	1.426E-13	463	0.087	0.175	4rgjA.pdb.gz
20	PDB:7myjC	0.243	0.464	1.426E-13	465	0.096	0.191	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K2H4	0.0	841	977	0.504	0.478	A0A0G2K2H4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=2 SV=1
2	A0A8I6AJE4	0.0	721	927	0.461	0.461	A0A8I6AJE4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=4 SV=1
3	A8JR46	0.0	565	1074	0.389	0.335	A8JR46_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Ire1 PE=4 SV=1
4	F1LSY7	0.0	843	965	0.504	0.484	F1LSY7_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=4 SV=2
5	Q09499	0.0	603	967	0.389	0.372	IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans OX=6239 GN=ire-1 PE=1 SV=2
6	Q76MJ5	0.0	1885	926	1.000	1.000	ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens OX=9606 GN=ERN2 PE=1 SV=4
7	Q9EQY0	0.0	841	977	0.499	0.473	ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus OX=10090 GN=Ern1 PE=1 SV=1
8	Q9Z2E3	0.0	1503	911	0.810	0.823	ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus OX=10090 GN=Ern2 PE=2 SV=2
9	O75460	2.25e-180	549	977	0.287	0.272	ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens OX=9606 GN=ERN1 PE=1 SV=2
10	E5QCG0	5.66e-137	425	625	0.259	0.384	E5QCG0_CAEEL Endoribonuclease OS=Caenorhabditis elegans OX=6239 GN=ire-1 PE=1 SV=1
11	Q6FUI3	3.15e-98	333	1036	0.190	0.170	Q6FUI3_CANGA non-specific serine/threonine protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IRE1 PE=4 SV=1
12	O94537	2.06e-95	326	1072	0.184	0.159	IRE1_SCHPO Sensor for unfolded proteins in the ER ire1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ire1 PE=1 SV=1
13	P32361	1.31e-94	325	1115	0.192	0.160	IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRE1 PE=1 SV=2
14	A0A1D8PE76	2.99e-88	308	1223	0.190	0.144	A0A1D8PE76_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IRE1 PE=4 SV=1
15	Q4WKP8	4.15e-85	298	1165	0.195	0.155	IREA_ASPFU Serine/threonine-protein kinase/endoribonuclease ireA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ireA PE=1 SV=1
16	Q7XIT1	7.62e-82	285	893	0.173	0.179	IRE1_ORYSJ Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Oryza sativa subsp. japonica OX=39947 GN=IRE1 PE=1 SV=1
17	F4KH40	1.86e-77	273	887	0.174	0.182	F4KH40_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=IRE1-1 PE=1 SV=1
18	Q93VJ2	1.96e-77	273	881	0.174	0.183	IRE1B_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1b OS=Arabidopsis thaliana OX=3702 GN=IRE1B PE=2 SV=1
19	Q9C5S2	5.17e-77	271	841	0.175	0.193	IRE1A_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1a OS=Arabidopsis thaliana OX=3702 GN=IRE1A PE=1 SV=1
20	Q504E3	4.86e-74	247	292	0.130	0.411	Q504E3_DANRE Endoplasmic reticulum to nucleus signaling 1 precursor OS=Danio rerio OX=7955 GN=zgc:109932 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	20	15.7	ABC1 atypical kinase-like domain
2	PF01636 APH	57	15.0	Phosphotransferase enzyme family
3	PF06293 Kdo	3.2e+02	12.1	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	1.8e-34	130.9	Protein kinase domain
5	PF17667 Pkinase_fungal	0.2	22.0	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	5.4e-15	67.0	Protein tyrosine and serine/threonine kinase
7	PF01011 PQQ	1.8e+02	13.3	PQQ enzyme repeat
8	PF13360 PQQ_2	0.073	24.3	PQQ-like domain
9	PF13570 PQQ_3	7	18.6	PQQ-like domain
10	PF06479 Ribonuc_2-5A	8e-36	134.4	Ribonuclease 2-5A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324173	0.944	78 kDa glucose-regulated protein
2	9606.ENSP00000216037	0.775	X-box-binding protein 1
3	9606.ENSP00000247668	0.751	TNF receptor-associated factor 2
4	9606.ENSP00000300087	0.727	Dynactin subunit 5
5	9606.ENSP00000356919	0.717	Cyclic AMP-dependent transcription factor ATF-6 alpha
6	9606.ENSP00000379217	0.699	Ubiquitin domain-containing protein UBFD1
7	9606.ENSP00000351908	0.690	Mitogen-activated protein kinase kinase kinase 5
8	9606.ENSP00000458770	0.690	Acyl carrier protein, mitochondrial
9	9606.ENSP00000395196	0.686	Probable glutamate--tRNA ligase, mitochondrial
10	9606.ENSP00000344223	0.638	Membrane-bound transcription factor site-1 protease
11	9606.ENSP00000327801	0.630	Protein disulfide-isomerase
12	9606.ENSP00000379042	0.607	ERO1-like protein alpha
13	9606.ENSP00000366395	0.600	E3 ubiquitin-protein ligase synoviolin
14	9606.ENSP00000317872	0.594	E3 ubiquitin-protein ligase RBBP6
15	9606.ENSP00000256497	0.589	ER degradation-enhancing alpha-mannosidase-like protein 1
16	9606.ENSP00000473631	0.587	DnaJ homolog subfamily C member 3
17	9606.ENSP00000368798	0.584	Membrane-bound transcription factor site-2 protease
18	9606.ENSP00000401445	0.566	Serine/threonine-protein kinase/endoribonuclease IRE1
19	9606.ENSP00000364349	0.554	Cyclic AMP-dependent transcription factor ATF-6 beta
20	9606.ENSP00000337746	0.551	Inositol-3-phosphate synthase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005515	0.998	protein binding
GO:0005524	0.998	ATP binding
GO:0016787	0.995	hydrolase activity
GO:0000287	0.995	magnesium ion binding
GO:0004519	0.987	endonuclease activity
GO:0042802	0.594	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0006950	0.990	response to stress
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.982	cellular response to stimulus
GO:0071704	0.979	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0034976	0.970	response to endoplasmic reticulum stress
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0044237	0.959	cellular metabolic process
GO:0031323	0.931	regulation of cellular metabolic process
GO:0006807	0.928	nitrogen compound metabolic process
GO:0060255	0.898	regulation of macromolecule metabolic process
GO:0006915	0.889	apoptotic process
GO:0019219	0.883	regulation of nucleobase-containing compound metabolic process
GO:0043170	0.877	macromolecule metabolic process
GO:0048518	0.865	positive regulation of biological process
GO:0031325	0.857	positive regulation of cellular metabolic process
GO:0019538	0.844	protein metabolic process
GO:0010468	0.814	regulation of gene expression
GO:0023052	0.810	signaling
GO:0051252	0.794	regulation of RNA metabolic process
GO:0043412	0.755	macromolecule modification
GO:0031326	0.745	regulation of cellular biosynthetic process
GO:0044260	0.737	cellular macromolecule metabolic process
GO:0044265	0.734	cellular macromolecule catabolic process
GO:0010556	0.733	regulation of macromolecule biosynthetic process
GO:0048519	0.722	negative regulation of biological process
GO:0048523	0.711	negative regulation of cellular process
GO:0006725	0.689	cellular aromatic compound metabolic process
GO:0006355	0.651	regulation of DNA-templated transcription
GO:0071840	0.638	cellular component organization or biogenesis
GO:0016043	0.628	cellular component organization
GO:1901360	0.612	organic cyclic compound metabolic process
GO:0034641	0.611	cellular nitrogen compound metabolic process
GO:0006139	0.600	nucleobase-containing compound metabolic process
GO:0010605	0.590	negative regulation of macromolecule metabolic process
GO:0051172	0.586	negative regulation of nitrogen compound metabolic process
GO:0031324	0.586	negative regulation of cellular metabolic process
GO:0007154	0.585	cell communication
GO:0090304	0.584	nucleic acid metabolic process
GO:0036211	0.549	protein modification process
GO:0034655	0.490	nucleobase-containing compound catabolic process
GO:0010604	0.488	positive regulation of macromolecule metabolic process
GO:0007165	0.484	signal transduction
GO:0051173	0.479	positive regulation of nitrogen compound metabolic process
GO:0048583	0.474	regulation of response to stimulus
GO:0042221	0.438	response to chemical
GO:0051246	0.418	regulation of protein metabolic process
GO:0006401	0.416	RNA catabolic process
GO:0009966	0.414	regulation of signal transduction
GO:0097194	0.395	execution phase of apoptosis
GO:0010033	0.393	response to organic substance
GO:0016310	0.378	phosphorylation
GO:0006996	0.377	organelle organization
GO:0034660	0.316	ncRNA metabolic process
GO:0034661	0.306	ncRNA catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0032991	0.997	protein-containing complex
GO:0016020	0.995	membrane
GO:0005829	0.994	cytosol
GO:0031090	0.973	organelle membrane
GO:0031984	0.939	organelle subcompartment
GO:0005789	0.932	endoplasmic reticulum membrane
GO:0070013	0.378	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:3.-.-.-	0.995	Hydrolases.
EC:3.1.-.-	0.991	Acting on ester bonds.

[back to server]