StarFunc result for job id Q76N89

User Input

>input (1606 residues)
MLLHLCSVKNLYQNRFLGLAAMASPSRNSQSRRRCKEPLRYSYNPDQFHNMDLRGGPHDG
VTIPRSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIDEV
LSENFLDYKNRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVTVK
NSAAPIFKSIGADETVQGQGSRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSI
FPALPHHGQERRSKIIGNTVNPIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGK
LSMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDDEEISLSTEPE
SAQIQDSPMNNLMESGSGEPRSEAPESSESWKPEQLGEGSVPDGPGNQSIELSRPAEEAA
VITEAGDQGMVSVGPEGAGELLAQVQKDIQPAPSAEELAEQLDLGEEASALLLEDGEAPA
STKEEPLEEEATTQSRAGREEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVS
ELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGL
SEVDTVAADPSALEEDREEPEGATPGTAHPGHSGGHFPSLANGAAQDGDTHPSTGSESDS
SPRQGGDHSCEGCDASCCSPSCYSSSCYSTSCYSSSCYSASCYSPSCYNGNRFASHTRFS
SVDSAKISESTVFSSQDDEEEENSAFESVPDSMQSPELDPESTNGAGPWQDELAAPSGHV
ERSPEGLESPVAGPSNRREGECPILHNSQPVSQLPSLRPEHHHYPTIDEPLPPNWEARID
SHGRVFYVDHVNRTTTWQRPTAAATPDGMRRSGSIQQMEQLNRRYQNIQRTIATERSEED
SGSQSCEQAPAGGGGGGGSDSEAESSQSSLDLRREGSLSPVNSQKITLLLQSPAVKFITN
PEFFTVLHANYSAYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLEL
PRGWEIKTDQQGKSFFVDHNSRATTFIDPRIPLQNGRLPNHLTHRQHLQRLRSYSAGEAS
EVSRNRGASLLARPGHSLVAAIRSQHQHESLPLAYNDKIVAFLRQPNIFEMLQERQPSLA
RNHTLREKIHYIRTEGNHGLEKLSCDADLVILLSLFEEEIMSYVPLQAAFHPGYSFSPRC
SPCSSPQNSPGLQRASARAPSPYRRDFEAKLRNFYRKLEAKGFGQGPGKIKLIIRRDHLL
EGTFNQVMAYSRKELQRNKLYVTFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSAN
DTYTVQISPMSAFVENHLEWFRFSGRILGLALIHQYLLDAFFTRPFYKALLRLPCDLSDL
EYLDEEFHQSLQWMKDNNITDILDLTFTVNEEVFGQVTERELKSGGANTQVTEKNKKEYI
ERMVKWRVERGVVQQTEALVRGFYEVVDSRLVSVFDARELELVIAGTAEIDLNDWRNNTE
YRGGYHDGHLVIRWFWAAVERFNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCIE
KWGKITSLPRAHTCFNRLDLPPYPSYSMLYEKLLTAVEETSTFGLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q76N89	1.000	1.000	0.000	1606	1.000	1.000	Q76N89.pdb.gz	HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens OX=9606 GN=HECW1 PE=1 SV=3
2	AFDB:A2A5Z6	0.174	0.360	1.653E-45	748	0.171	0.368	A2A5Z6.pdb.gz	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
3	PDB:7jq9A	0.158	0.107	6.610E-31	2427	0.094	0.062	7jq9A.pdb.gz
4	PDB:7mopA	0.146	0.098	5.052E-29	2445	0.090	0.059	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
5	AFDB:Q9JIS1	0.060	0.062	4.962E-7	1555	0.076	0.078	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
6	AFDB:Q99NE5	0.054	0.059	7.360E-7	1463	0.090	0.099	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
7	PDB:1cjyA	0.067	0.161	4.197E-6	633	0.021	0.052	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
8	AFDB:Q4KWH5	0.069	0.066	5.830E-6	1682	0.092	0.088	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
9	AFDB:Q9Z2I4	0.045	0.052	1.641E-5	1366	0.073	0.086	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
10	PDB:6kxkD	0.071	0.186	2.134E-5	553	0.027	0.080	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
11	AFDB:Q9VID5	0.083	0.123	9.671E-5	1039	0.082	0.126	Q9VID5.pdb.gz	Q9VID5_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=3 SV=2
12	PDB:5izrC	0.065	0.154	1.033E-4	659	0.014	0.033	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	PDB:3nsjA	0.062	0.182	1.458E-4	530	0.018	0.055	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
14	AFDB:Q6WKZ4	0.077	0.094	2.025E-4	1283	0.090	0.113	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
15	PDB:5iz5A	0.069	0.140	2.271E-4	757	0.015	0.032	5iz5A.pdb.gz
16	AFDB:Q68FE6	0.061	0.078	2.591E-4	1223	0.077	0.101	Q68FE6.pdb.gz	RIPR1_MOUSE Rho family-interacting cell polarization regulator 1 OS=Mus musculus OX=10090 GN=Ripor1 PE=1 SV=2
17	PDB:5ixcA	0.066	0.149	3.369E-4	684	0.013	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:4rj9A	0.071	0.613	3.906E-4	161	0.016	0.155	4rj9A.pdb.gz
19	AFDB:O14976	0.058	0.070	4.241E-4	1311	0.064	0.078	O14976.pdb.gz	GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2
20	PDB:4gnkB	0.069	0.141	6.393E-4	769	0.016	0.034	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76N89	0.0	3325	1606	1.000	1.000	HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens OX=9606 GN=HECW1 PE=1 SV=3
2	Q9P2P5	0.0	1313	1572	0.410	0.419	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
3	Q9W326	0.0	731	1426	0.217	0.245	Q9W326_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Hecw PE=2 SV=3
4	P46935	2.19e-123	411	887	0.120	0.218	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
5	Q92462	3.37e-123	407	767	0.144	0.302	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
6	Q3KRP0	4.80e-122	408	910	0.120	0.212	Q3KRP0_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=si:ch211-79l17.5 PE=2 SV=1
7	P39940	6.91e-122	404	809	0.150	0.298	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
8	P46934	8.05e-122	417	1319	0.120	0.146	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
9	F1LRN8	3.02e-121	404	856	0.146	0.275	F1LRN8_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=4
10	Q62940	3.49e-121	405	887	0.119	0.215	NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus OX=10116 GN=Nedd4 PE=1 SV=1
11	A0A8I6A6J7	8.35e-121	405	921	0.146	0.255	A0A8I6A6J7_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
12	A0A8I6GKS9	1.54e-120	405	942	0.146	0.248	A0A8I6GKS9_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
13	A0A0G2JUY1	2.04e-120	404	921	0.146	0.254	A0A0G2JUY1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=2
14	Q9VVI3	4.45e-120	405	1007	0.120	0.192	NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster OX=7227 GN=Nedd4 PE=1 SV=2
15	Q5U1Z5	1.02e-118	383	440	0.116	0.425	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
16	U6C7R6	9.02e-118	395	867	0.120	0.223	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
17	Q96J02	2.11e-117	395	903	0.147	0.261	ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=2
18	A0A590UJQ1	3.25e-117	394	900	0.147	0.262	A0A590UJQ1_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
19	Q8C863	4.43e-117	393	864	0.146	0.272	ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus OX=10090 GN=Itch PE=1 SV=2
20	O14326	1.18e-116	389	786	0.123	0.251	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	5.1e-08	44.5	C2 domain
2	PF00632 HECT	4.7e-99	343.3	HECT-domain (ubiquitin-transferase)
3	PF18436 HECW1_helix	2.7e-35	131.6	Helical box domain of E3 ubiquitin-protein ligase HECW1
4	PF16562 HECW_N	4.4e-53	189.6	N-terminal domain of E3 ubiquitin-protein ligase HECW1 and 2
5	PF00397 WW	8.3e-14	62.7	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379228

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441543	0.937	Polyubiquitin-C
2	9606.ENSP00000368169	0.936	Segment polarity protein dishevelled homolog DVL-1
3	9606.ENSP00000388107	0.926	Ubiquitin-60S ribosomal protein L40
4	9606.ENSP00000272317	0.917	Ubiquitin-40S ribosomal protein S27a
5	9606.ENSP00000304697	0.916	Polyubiquitin-B
6	9606.ENSP00000317331	0.842	Translocon-associated protein subunit delta
7	9606.ENSP00000253814	0.796	NEDD4 family-interacting protein 1
8	9606.ENSP00000270142	0.771	Superoxide dismutase [Cu-Zn]
9	9606.ENSP00000009041	0.681	STARD3 N-terminal-like protein
10	9606.ENSP00000371398	0.672	Zinc finger protein GLIS3
11	9606.ENSP00000477868	0.672	TOX high mobility group box family member 4
12	9606.ENSP00000199448	0.667	Mammalian ependymin-related protein 1
13	9606.ENSP00000263955	0.647	Serine/threonine-protein kinase 17B
14	9606.ENSP00000261427	0.636	Ubiquitin-conjugating enzyme E2 K
15	9606.ENSP00000382863	0.625	Chromodomain-helicase-DNA-binding protein 8
16	9606.ENSP00000350364	0.611	Neuronal growth regulator 1
17	9606.ENSP00000269305	0.609	Cellular tumor antigen p53
18	9606.ENSP00000463069	0.603	E3 ubiquitin-protein ligase RNF43
19	9606.ENSP00000449500	0.589	Ribonuclease kappa
20	9606.ENSP00000379217	0.586	Ubiquitin domain-containing protein UBFD1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0048583	0.975	regulation of response to stimulus
GO:0048519	0.974	negative regulation of biological process
GO:0009966	0.958	regulation of signal transduction
GO:0048523	0.949	negative regulation of cellular process
GO:0023057	0.809	negative regulation of signaling
GO:0010648	0.809	negative regulation of cell communication
GO:0030111	0.743	regulation of Wnt signaling pathway
GO:0009968	0.727	negative regulation of signal transduction
GO:0030178	0.687	negative regulation of Wnt signaling pathway
GO:0060828	0.686	regulation of canonical Wnt signaling pathway
GO:0009987	0.649	cellular process
GO:0090090	0.633	negative regulation of canonical Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.958	organelle
GO:0043229	0.944	intracellular organelle
GO:0043231	0.840	intracellular membrane-bounded organelle
GO:0016020	0.354	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]