StarFunc result for job id Q7KZ85

User Input

>input (1726 residues)
MSDFVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGFIND
DDDEDEGEEDEGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRR
VKKMSDDEDDDEEEYGKEEHEKEAIAEEIFQDGEGEEGQEAMEAPMAPPEEEEEDDEESD
IDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEY
EYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQL
RSIPVKGAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPASSFSRKGPSTIQKIK
EALGFMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKM
QAYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPKMQN
AAKASRKKLKRVREEGDEEGEGDEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFG
LTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREP
LVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDDQFLKICLAE
DEGLLTTDISIDLKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQF
LYVQMAKELKNKLLAEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIR
VLGIAFSSARDHPVFCALVNGEGEVTDFLRLPHFTKRRTAWREEEREKKAQDIETLKKFL
LNKKPHVVTVAGENRDAQMLIEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSE
AEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYC
EFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTM
CHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESA
EDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTA
YRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAIRNDETGLWQCPF
CQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVG
MTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQ
QRTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQH
VDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDR
KKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQI
FPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMT
SQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPS
YSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQ
WLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6gmhM	0.462	0.777	0.000	1002	0.572	0.986	6gmhM.pdb.gz	Structure of activated transcription complex Pol II-DSIF-PAF-SPT6.
2	AFDB:Q62383	0.717	0.717	0.000	1726	0.980	0.980	Q62383.pdb.gz	SPT6H_MOUSE Transcription elongation factor SPT6 OS=Mus musculus OX=10090 GN=Supt6h PE=1 SV=2
3	PDB:7oopM	0.464	0.980	4.173E-100	810	0.468	0.998	7oopM.pdb.gz	Structural basis of human transcription-DNA repair coupling.
4	AFDB:Q9CAM1	0.520	0.666	2.398E-85	1322	0.228	0.297	Q9CAM1.pdb.gz	SPT62_ARATH Transcription elongation factor SPT6-like OS=Arabidopsis thaliana OX=3702 GN=At1g63210 PE=1 SV=2
5	AFDB:Q586C8	0.430	0.476	8.117E-45	1543	0.136	0.152	Q586C8.pdb.gz	Q586C8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.275 PE=4 SV=1
6	PDB:3ps5A	0.061	0.164	3.763E-5	529	0.030	0.098	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
7	PDB:5xzrA	0.044	0.136	1.915E-4	519	0.021	0.069	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
8	PDB:7essB	0.064	0.483	5.426E-3	151	0.020	0.232	7essB.pdb.gz
9	PDB:4k2rA	0.050	0.140	6.801E-3	551	0.016	0.051	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
10	PDB:1k9aB	0.046	0.171	8.920E-3	441	0.020	0.077	1k9aB.pdb.gz
11	PDB:4fl2A	0.040	0.120	9.332E-3	555	0.018	0.056	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:2ix1A	0.050	0.112	1.224E-2	643	0.031	0.084	2ix1A.pdb.gz	Unravelling the Dynamics of RNA Degradation by Ribonuclease II and its RNA-Bound Complex
13	PDB:3wxmB	0.062	0.237	1.280E-2	357	0.015	0.073	3wxmB.pdb.gz	Structural basis for mRNA surveillance by archaeal Pelota and GTP-bound EF1 alpha complex
14	AFDB:Q7KRW8	0.053	0.069	2.894E-1	1066	0.076	0.124	Q7KRW8.pdb.gz	PRP39_DROME Pre-mRNA-processing factor 39 OS=Drosophila melanogaster OX=7227 GN=Prp39 PE=1 SV=1
15	AFDB:Q08562	0.034	0.035	3.468E-1	1619	0.047	0.050	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
16	AFDB:Q8IZD9	0.064	0.057	3.796E-1	2030	0.076	0.065	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
17	AFDB:Q9Y6R4	0.045	0.047	4.978E-1	1608	0.114	0.122	Q9Y6R4.pdb.gz	M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP3K4 PE=1 SV=2
18	AFDB:Q62769	0.058	0.061	9.806E-1	1622	0.093	0.099	Q62769.pdb.gz	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
19	AFDB:Q54TL0	0.035	0.043	1.026	1255	0.044	0.061	Q54TL0.pdb.gz	KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum OX=44689 GN=kif7 PE=2 SV=1
20	AFDB:Q24367	0.065	0.100	1.286	859	0.062	0.125	Q24367.pdb.gz	Q24367_DROME Inscuteable OS=Drosophila melanogaster OX=7227 GN=insc PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q62383	0.0	3528	1726	0.981	0.981	SPT6H_MOUSE Transcription elongation factor SPT6 OS=Mus musculus OX=10090 GN=Supt6h PE=1 SV=2
2	Q7KZ85	0.0	3588	1726	1.000	1.000	SPT6H_HUMAN Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2
3	Q8UVK2	0.0	2591	1726	0.790	0.790	SPT6H_DANRE Transcription elongation factor SPT6 OS=Danio rerio OX=7955 GN=supt6h PE=1 SV=1
4	Q9W420	0.0	1474	1831	0.469	0.442	SPT6H_DROME Transcription elongation factor SPT6 OS=Drosophila melanogaster OX=7227 GN=Spt6 PE=1 SV=1
5	A8MS85	8.22e-159	530	1647	0.264	0.276	SPT61_ARATH Transcription elongation factor SPT6 homolog OS=Arabidopsis thaliana OX=3702 GN=SPT6 PE=1 SV=1
6	Q9CAM1	2.74e-130	443	1322	0.221	0.289	SPT62_ARATH Transcription elongation factor SPT6-like OS=Arabidopsis thaliana OX=3702 GN=At1g63210 PE=1 SV=2
7	Q09915	4.64e-124	426	1365	0.206	0.261	SPT6_SCHPO Transcription elongation factor spt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt6 PE=1 SV=2
8	P23615	1.02e-90	328	1451	0.218	0.259	SPT6_YEAST Transcription elongation factor SPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT6 PE=1 SV=1
9	Q3MNT0	5.58e-72	268	1401	0.174	0.214	SPT6_CANAL Transcription elongation factor SPT6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPT6 PE=3 SV=1
10	P46837	1.77e-18	94.4	773	0.059	0.132	YHGF_ECOLI Protein YhgF OS=Escherichia coli (strain K12) OX=83333 GN=yhgF PE=1 SV=3
11	Q8SRG7	7.26e-14	79.7	894	0.031	0.059	Q8SRG7_ENCCU CHROMATIN STRUCTURE MODULATOR OS=Encephalitozoon cuniculi (strain GB-M1) OX=284813 GN=ECU07_1690 PE=1 SV=1
12	Q586C8	3.28e-09	64.7	1543	0.063	0.070	Q586C8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.275 PE=4 SV=1
13	Q385A3	6.14e-07	57.0	935	0.031	0.058	Q385A3_TRYB2 YqgF/RNase H-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4500 PE=4 SV=1
14	O74835	0.002	45.4	1690	0.010	0.011	RRP5_SCHPO rRNA biogenesis protein rrp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp5 PE=1 SV=1
15	Q05022	0.002	45.4	1729	0.010	0.010	RRP5_YEAST rRNA biogenesis protein RRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP5 PE=1 SV=1
16	F4IJV4	0.18	39.3	1044	0.024	0.039	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12836 HHH_3	0.00036	32.0	Helix-hairpin-helix motif
2	PF14635 HHH_7	3.3e-49	176.9	Helix-hairpin-helix motif
3	PF17674 HHH_9	0.033	26.4	HHH domain
4	PF14641 HTH_44	2.9e-23	93.9	Helix-turn-helix DNA-binding domain of SPT6
5	PF00575 S1	0.0025	29.4	S1 RNA binding domain
6	PF00017 SH2	0.049	25.0	SH2 domain
7	PF14633 SH2_2	2.4e-79	277.2	SH2 domain
8	PF14632 SPT6_acidic	2.1e-09	48.9	Acidic N-terminal SPT6
9	PF09371 Tex_N	0.0034	28.6	Tex-like protein N-terminal domain
10	PF16921 Tex_YqgF	0.44	22.4	Tex protein YqgF-like domain
11	PF14639 YqgF	2.2e-67	237.0	Holliday-junction resolvase-like of SPT6
12	PF04810 zf-Sec23_Sec24	5.1e+02	12.1	Sec23/Sec24 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319104

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295321	0.999	Protein IWS1 homolog
2	9606.ENSP00000470252	0.999	Transcription elongation factor SPT5
3	9606.ENSP00000480158	0.999	DNA-directed RNA polymerase II subunit RPB1
4	9606.ENSP00000225504	0.998	Transcription elongation factor SPT4
5	9606.ENSP00000216297	0.997	FACT complex subunit SPT16
6	9606.ENSP00000355013	0.993	RNA polymerase-associated protein CTR9 homolog
7	9606.ENSP00000278412	0.991	FACT complex subunit SSRP1
8	9606.ENSP00000374280	0.988	RNA polymerase-associated protein RTF1 homolog
9	9606.ENSP00000219252	0.987	DNA-directed RNA polymerase II subunit RPB3
10	9606.ENSP00000299601	0.982	RNA polymerase-associated protein LEO1
11	9606.ENSP00000356405	0.982	Parafibromin
12	9606.ENSP00000428426	0.982	Transcription elongation factor A protein 1
13	9606.ENSP00000476960	0.976	Histone cluster 2 H3 pseudogene 2
14	9606.ENSP00000370625	0.974	DNA-directed RNA polymerase II subunit RPB2
15	9606.ENSP00000478303	0.968	DNA-directed RNA polymerases I, II, and III subunit RPABC1
16	9606.ENSP00000301788	0.967	DNA-directed RNA polymerase II subunit RPB7
17	9606.ENSP00000324124	0.966	DNA-directed RNA polymerases I, II, and III subunit RPABC5
18	9606.ENSP00000386759	0.966	Histone-lysine N-methyltransferase SETD2
19	9606.ENSP00000483667	0.952	Chromodomain-helicase-DNA-binding protein 1
20	9606.ENSP00000403852	0.950	DNA-directed RNA polymerases I, II, and III subunit RPABC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.940	nucleic acid binding
GO:0042393	0.928	histone binding
GO:0003723	0.888	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0031323	0.973	regulation of cellular metabolic process
GO:0006325	0.968	chromatin organization
GO:0010468	0.958	regulation of gene expression
GO:0019219	0.956	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.945	regulation of RNA metabolic process
GO:0048518	0.941	positive regulation of biological process
GO:0034243	0.939	regulation of transcription elongation by RNA polymerase II
GO:0032786	0.930	positive regulation of DNA-templated transcription, elongation
GO:0006338	0.929	chromatin remodeling
GO:0032968	0.919	positive regulation of transcription elongation by RNA polymerase II
GO:0071704	0.403	organic substance metabolic process
GO:0044238	0.356	primary metabolic process
GO:0006807	0.346	nitrogen compound metabolic process
GO:0043170	0.343	macromolecule metabolic process
GO:0044237	0.313	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.944	protein-containing complex
GO:0043232	0.766	intracellular non-membrane-bounded organelle
GO:0005737	0.743	cytoplasm
GO:0140513	0.634	nuclear protein-containing complex
GO:0005694	0.547	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]