StarFunc result for job id Q7KZF4

User Input

>input (910 residues)
MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
RRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTI
ENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSET
PEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWS
IAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKL
NSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
MDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAH
YEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIAS
HPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTL
SPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
DDADEFGYSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK49	0.988	0.988	0.000	910	1.000	1.000	A0A140VK49.pdb.gz	A0A140VK49_HUMAN Staphylococcal nuclease domain-containing protein OS=Homo sapiens OX=9606 GN=SND1 PE=2 SV=1
2	AFDB:Q19328	0.639	0.637	0.000	914	0.470	0.468	Q19328.pdb.gz	Q19328_CAEEL Staphylococcal nuclease domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tsn-1 PE=1 SV=1
3	AFDB:Q7ZT42	0.850	0.861	0.000	897	0.823	0.835	Q7ZT42.pdb.gz	SND1_DANRE Staphylococcal nuclease domain-containing protein 1 OS=Danio rerio OX=7955 GN=snd1 PE=2 SV=1
4	AFDB:Q9W0S7	0.672	0.661	0.000	926	0.509	0.500	Q9W0S7.pdb.gz	SND1_DROME Staphylococcal nuclease domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=Tudor-SN PE=1 SV=1
5	AFDB:Q8VZG7	0.575	0.534	1.448E-82	991	0.359	0.330	Q8VZG7.pdb.gz	TSN1_ARATH Ribonuclease TUDOR 1 OS=Arabidopsis thaliana OX=3702 GN=TSN1 PE=1 SV=1
6	AFDB:Q9FLT0	0.606	0.565	5.169E-82	985	0.363	0.335	Q9FLT0.pdb.gz	TSN2_ARATH Ribonuclease TUDOR 2 OS=Arabidopsis thaliana OX=3702 GN=TSN2 PE=1 SV=1
7	AFDB:Q9Y7U7	0.612	0.633	6.553E-76	878	0.299	0.310	Q9Y7U7.pdb.gz	SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snd1 PE=1 SV=1
8	AFDB:Q382B8	0.314	0.309	1.309E-68	924	0.252	0.248	Q382B8.pdb.gz	Q382B8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5780 PE=4 SV=1
9	AFDB:Q8II01	0.554	0.468	4.821E-67	1098	0.242	0.200	Q8II01.pdb.gz	Q8II01_PLAF7 Tudor staphylococcal nuclease OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1136300 PE=4 SV=1
10	AFDB:Q99MV7	0.205	0.120	1.077E-26	1640	0.178	0.099	Q99MV7.pdb.gz	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
11	PDB:2ix1A	0.080	0.108	8.382E-3	643	0.078	0.110	2ix1A.pdb.gz	Unravelling the Dynamics of RNA Degradation by Ribonuclease II and its RNA-Bound Complex
12	PDB:5c0wJ	0.076	0.073	9.828E-3	970	0.097	0.091	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
13	PDB:7abi7	0.061	0.223	1.958E-2	236	0.031	0.119	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
14	PDB:7r1dC	0.058	0.252	2.553E-2	192	0.015	0.073	7r1dC.pdb.gz
15	PDB:6f3hB	0.075	0.085	3.509E-2	790	0.076	0.087	6f3hB.pdb.gz	Structural analysis of mtEXO mitochondrial RNA degradosome reveals tight coupling of nuclease and helicase components.
16	PDB:5g06J	0.069	0.066	3.700E-2	993	0.053	0.048	5g06J.pdb.gz
17	PDB:4ifdJ	0.078	0.075	4.823E-2	948	0.098	0.094	4ifdJ.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
18	PDB:6hiwDB	0.046	0.040	5.086E-2	1111	0.052	0.042	6hiwDB.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:3mp8A	0.056	0.097	6.630E-2	513	0.023	0.041	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
20	PDB:2eyzA	0.054	0.115	7.774E-2	304	0.043	0.128	2eyzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK49	0.0	1887	910	1.000	1.000	A0A140VK49_HUMAN Staphylococcal nuclease domain-containing protein OS=Homo sapiens OX=9606 GN=SND1 PE=2 SV=1
2	Q19328	0.0	811	914	0.468	0.466	Q19328_CAEEL Staphylococcal nuclease domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tsn-1 PE=1 SV=1
3	Q66X93	0.0	1843	909	0.970	0.971	SND1_RAT Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Snd1 PE=1 SV=1
4	Q78PY7	0.0	1848	910	0.974	0.974	SND1_MOUSE Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus OX=10090 GN=Snd1 PE=1 SV=1
5	Q7KZF4	0.0	1887	910	1.000	1.000	SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1
6	Q7ZT42	0.0	1557	897	0.825	0.837	SND1_DANRE Staphylococcal nuclease domain-containing protein 1 OS=Danio rerio OX=7955 GN=snd1 PE=2 SV=1
7	Q9W0S7	0.0	869	926	0.513	0.504	SND1_DROME Staphylococcal nuclease domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=Tudor-SN PE=1 SV=1
8	Q9FLT0	1.26e-142	450	985	0.370	0.342	TSN2_ARATH Ribonuclease TUDOR 2 OS=Arabidopsis thaliana OX=3702 GN=TSN2 PE=1 SV=1
9	Q8VZG7	3.77e-138	439	991	0.365	0.335	TSN1_ARATH Ribonuclease TUDOR 1 OS=Arabidopsis thaliana OX=3702 GN=TSN1 PE=1 SV=1
10	Q9Y7U7	5.80e-106	350	878	0.308	0.319	SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snd1 PE=1 SV=1
11	Q382B8	1.49e-48	188	924	0.264	0.260	Q382B8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5780 PE=4 SV=1
12	Q8II01	1.81e-25	116	1098	0.132	0.109	Q8II01_PLAF7 Tudor staphylococcal nuclease OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1136300 PE=4 SV=1
13	A9CPT4	3.36e-09	63.5	1133	0.053	0.042	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
14	Q99MV1	1.38e-08	61.2	1172	0.042	0.032	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
15	Q9BXT4	1.46e-08	61.2	1180	0.038	0.030	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
16	P61407	4.75e-08	59.7	2134	0.043	0.018	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
17	Q99MV7	1.67e-06	54.7	1640	0.078	0.043	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
18	Q1XG89	1.28e-05	51.6	1759	0.054	0.028	TDR12_BOMMO Putative ATP-dependent RNA helicase TDRD12 OS=Bombyx mori OX=7091 GN=TDRD12 PE=1 SV=2
19	Q58EK5	1.56e-05	51.2	1175	0.035	0.027	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
20	Q5VCS6	4.35e-05	50.1	1040	0.038	0.034	TDRD5_MOUSE Tudor domain-containing protein 5 OS=Mus musculus OX=10090 GN=Tdrd5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05641 Agenet	3.8e+02	13.0	Agenet domain
2	PF00565 SNase	2.7e-66	232.2	Staphylococcal nuclease homologue
3	PF00567 TUDOR	6.2e-24	95.8	Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346762

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338235	0.995	Protein LYRIC
2	9606.ENSP00000339992	0.974	Transcriptional activator Myb
3	9606.ENSP00000377681	0.967	Ras GTPase-activating protein-binding protein 1
4	9606.ENSP00000245255	0.944	Piwi-like protein 1
5	9606.ENSP00000313829	0.927	KH domain-containing, RNA-binding, signal transduction-associated protein 1
6	9606.ENSP00000362608	0.927	Serine/threonine-protein kinase pim-1
7	9606.ENSP00000251849	0.905	RAF proto-oncogene serine/threonine-protein kinase
8	9606.ENSP00000290277	0.904	Serine/threonine-protein kinase A-Raf
9	9606.ENSP00000371067	0.903	Tyrosine-protein kinase JAK2
10	9606.ENSP00000319060	0.900	Calcium/calmodulin-dependent protein kinase type II subunit gamma
11	9606.ENSP00000339740	0.900	Calcium/calmodulin-dependent protein kinase type II subunit delta
12	9606.ENSP00000379098	0.900	Calcium/calmodulin-dependent protein kinase type II subunit beta
13	9606.ENSP00000381412	0.900	Calcium/calmodulin-dependent protein kinase type II subunit alpha
14	9606.ENSP00000300134	0.890	Signal transducer and activator of transcription 6
15	9606.ENSP00000220592	0.866	Protein argonaute-2
16	9606.ENSP00000243253	0.861	Protein transport protein Sec61 subunit alpha isoform 1
17	9606.ENSP00000350170	0.817	Fragile X mental retardation syndrome-related protein 1
18	9606.ENSP00000359127	0.788	Diphthine methyl ester synthase
19	9606.ENSP00000223073	0.769	RNA-binding protein 28
20	9606.ENSP00000437256	0.762	Endoribonuclease Dicer

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.968	nucleic acid binding
GO:0003723	0.963	RNA binding
GO:0003824	0.932	catalytic activity
GO:0004518	0.730	nuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0046483	0.995	heterocycle metabolic process
GO:0006725	0.995	cellular aromatic compound metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0050794	0.993	regulation of cellular process
GO:0006139	0.992	nucleobase-containing compound metabolic process
GO:0016070	0.976	RNA metabolic process
GO:0044260	0.968	cellular macromolecule metabolic process
GO:0032501	0.935	multicellular organismal process
GO:1901361	0.927	organic cyclic compound catabolic process
GO:0046700	0.927	heterocycle catabolic process
GO:0044270	0.901	cellular nitrogen compound catabolic process
GO:0051726	0.772	regulation of cell cycle
GO:0006401	0.763	RNA catabolic process
GO:0032502	0.640	developmental process
GO:0019222	0.556	regulation of metabolic process
GO:0060255	0.532	regulation of macromolecule metabolic process
GO:0048518	0.451	positive regulation of biological process
GO:0001503	0.423	ossification
GO:0034660	0.420	ncRNA metabolic process
GO:0031323	0.408	regulation of cellular metabolic process
GO:0080090	0.386	regulation of primary metabolic process
GO:0010468	0.366	regulation of gene expression
GO:0048519	0.363	negative regulation of biological process
GO:0048522	0.340	positive regulation of cellular process
GO:0050896	0.338	response to stimulus
GO:0051171	0.338	regulation of nitrogen compound metabolic process
GO:0030154	0.336	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005634	0.990	nucleus
GO:0016020	0.975	membrane
GO:0031981	0.905	nuclear lumen
GO:0005576	0.861	extracellular region
GO:0031982	0.851	vesicle
GO:0070062	0.768	extracellular exosome
GO:0032991	0.654	protein-containing complex
GO:0005739	0.322	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.730	Acting on ester bonds.

[back to server]