StarFunc result for job id Q7KZI7

User Input

>input (788 residues)
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIG
KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS
NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTST
NRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHP
NKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAG
QLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPE
SKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDA
NSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIAS
KIANELKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7ETY4	0.578	0.597	0.000	763	0.968	1.000	E7ETY4.pdb.gz	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
2	AFDB:Q7KZI7	1.000	1.000	0.000	788	1.000	1.000	Q7KZI7.pdb.gz	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
3	AFDB:O08679	0.652	0.710	6.776E-104	722	0.898	0.981	O08679.pdb.gz	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
4	AFDB:Q8VHJ5	0.589	0.583	7.095E-83	795	0.690	0.684	Q8VHJ5.pdb.gz	MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus OX=10090 GN=Mark1 PE=1 SV=2
5	AFDB:P27448	0.558	0.584	5.713E-79	753	0.637	0.667	P27448.pdb.gz	MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5
6	AFDB:E1JGN0	0.546	0.381	7.109E-67	1141	0.503	0.347	E1JGN0.pdb.gz	E1JGN0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
7	AFDB:A0A0G2JTD8	0.428	0.488	2.723E-54	688	0.478	0.548	A0A0G2JTD8.pdb.gz	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
8	AFDB:A1ZBL7	0.417	0.332	2.315E-51	993	0.415	0.329	A1ZBL7.pdb.gz	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
9	AFDB:Q8CFH6	0.395	0.335	2.107E-37	931	0.284	0.241	Q8CFH6.pdb.gz	SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus OX=10090 GN=Sik2 PE=1 SV=1
10	AFDB:Q21017	0.399	0.383	1.081E-36	822	0.260	0.249	Q21017.pdb.gz	KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans OX=6239 GN=kin-29 PE=1 SV=2
11	PDB:7myjC	0.332	0.553	4.879E-30	465	0.209	0.355	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:6b1uA	0.334	0.586	1.352E-28	442	0.213	0.380	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
13	PDB:4zhxA	0.331	0.627	6.589E-28	409	0.175	0.337	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:4rerA	0.334	0.563	2.755E-27	459	0.179	0.307	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:4rewA	0.322	0.612	4.593E-27	411	0.173	0.331	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:5ufuA	0.330	0.694	2.128E-26	369	0.166	0.355	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:5u6yA	0.314	0.530	5.601E-25	459	0.135	0.231	5u6yA.pdb.gz
18	PDB:4d28C	0.310	0.835	4.109E-24	279	0.142	0.401	4d28C.pdb.gz
19	PDB:4cztD	0.302	0.741	1.633E-23	302	0.141	0.368	4cztD.pdb.gz
20	PDB:6byrA	0.320	0.610	1.708E-21	405	0.121	0.235	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTD8	651	744	0.494	0.523	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
2	A0A8I6A623	648	688	0.484	0.554	A0A8I6A623_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=1
3	A1ZBL5	711	951	0.501	0.415	A1ZBL5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
4	A1ZBL7	599	993	0.428	0.339	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
5	A1ZBL9	736	1170	0.510	0.344	A1ZBL9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
6	D4A6T9	721	752	0.546	0.572	D4A6T9_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Mark4 PE=3 SV=1
7	E1JGM9	605	827	0.420	0.400	E1JGM9_DROME Par-1, isoform S OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
8	E1JGN0	698	1141	0.491	0.339	E1JGN0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
9	E7ETY4	1565	763	0.968	1.000	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
10	E9PC69	1600	778	0.987	1.000	E9PC69_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=3
11	O08678	1018	793	0.701	0.696	MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus OX=10116 GN=Mark1 PE=1 SV=1
12	O08679	1411	722	0.892	0.974	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
13	P27448	936	753	0.648	0.679	MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5
14	Q03141	938	753	0.646	0.676	MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus OX=10090 GN=Mark3 PE=1 SV=2
15	Q05512	1565	776	0.967	0.982	MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus OX=10090 GN=Mark2 PE=1 SV=3
16	Q6NPA6	603	833	0.421	0.399	Q6NPA6_DROME Par-1, isoform L OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
17	Q7KZI7	1634	788	1.000	1.000	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
18	Q7YU80	601	1046	0.415	0.313	Q7YU80_DROME Par-1, isoform R OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
19	Q8CIP4	719	752	0.546	0.572	MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus OX=10090 GN=Mark4 PE=1 SV=1
20	Q8VHJ5	1014	795	0.701	0.694	MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus OX=10090 GN=Mark1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.027	25.2	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	65	13.9	Haspin like kinase domain
3	PF02149 KA1	5.3e-17	72.5	Kinase associated domain 1
4	PF06293 Kdo	31	15.4	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	0.0046	27.9	Kinase-like
6	PF00069 Pkinase	4.5e-73	257.5	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	6.4e-42	155.2	Protein tyrosine and serine/threonine kinase
8	PF01163 RIO1	2.7	19.1	RIO1 family
9	PF00627 UBA	0.045	25.0	UBA/TS-N domain
10	PF08587 UBA_2	3.7	19.0	Ubiquitin associated domain (UBA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385751

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340820	0.990	Microtubule-associated protein tau
2	9606.ENSP00000357722	0.986	Protein S100-A8
3	9606.ENSP00000324856	0.966	Serine/threonine-protein kinase STK11
4	9606.ENSP00000353508	0.945	Microtubule-associated protein 2
5	9606.ENSP00000261537	0.930	E3 ubiquitin-protein ligase MIB1
6	9606.ENSP00000356515	0.925	Utrophin
7	9606.ENSP00000258418	0.923	Calcium-binding protein 39
8	9606.ENSP00000336655	0.912	STE20-related kinase adapter protein alpha
9	9606.ENSP00000352927	0.911	Microtubule cross-linking factor 1
10	9606.ENSP00000194530	0.902	STE20-related kinase adapter protein beta
11	9606.ENSP00000248975	0.889	14-3-3 protein eta
12	9606.ENSP00000379287	0.887	14-3-3 protein zeta/delta
13	9606.ENSP00000363921	0.841	Partitioning defective 3 homolog
14	9606.ENSP00000295797	0.837	Protein kinase C iota type
15	9606.ENSP00000354837	0.827	Rho guanine nucleotide exchange factor 2
16	9606.ENSP00000361930	0.827	14-3-3 protein beta/alpha
17	9606.ENSP00000371267	0.820	14-3-3 protein theta
18	9606.ENSP00000264335	0.798	14-3-3 protein epsilon
19	9606.ENSP00000366604	0.795	Splicing factor 1
20	9606.ENSP00000354923	0.776	Dystrophin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.988	protein binding
GO:0004674	0.988	protein serine/threonine kinase activity
GO:0050321	0.987	tau-protein kinase activity
GO:1901363	0.888	heterocyclic compound binding
GO:0097159	0.881	organic cyclic compound binding
GO:0000287	0.827	magnesium ion binding
GO:0032555	0.827	purine ribonucleotide binding
GO:0035639	0.820	purine ribonucleoside triphosphate binding
GO:0005524	0.803	ATP binding
GO:0003676	0.459	nucleic acid binding
GO:0098772	0.429	molecular function regulator activity
GO:0140677	0.380	molecular function activator activity
GO:0045296	0.320	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0036211	0.988	protein modification process
GO:0006796	0.986	phosphate-containing compound metabolic process
GO:0016310	0.982	phosphorylation
GO:0006468	0.946	protein phosphorylation
GO:0048518	0.848	positive regulation of biological process
GO:0050896	0.783	response to stimulus
GO:0048522	0.761	positive regulation of cellular process
GO:0051128	0.735	regulation of cellular component organization
GO:0019222	0.701	regulation of metabolic process
GO:0031323	0.682	regulation of cellular metabolic process
GO:0065009	0.637	regulation of molecular function
GO:0060255	0.598	regulation of macromolecule metabolic process
GO:0080090	0.545	regulation of primary metabolic process
GO:0051716	0.498	cellular response to stimulus
GO:0051171	0.484	regulation of nitrogen compound metabolic process
GO:0018193	0.475	peptidyl-amino acid modification
GO:0031325	0.460	positive regulation of cellular metabolic process
GO:0007165	0.455	signal transduction
GO:0032501	0.454	multicellular organismal process
GO:0016043	0.430	cellular component organization
GO:0010604	0.421	positive regulation of macromolecule metabolic process
GO:0051173	0.418	positive regulation of nitrogen compound metabolic process
GO:0018209	0.414	peptidyl-serine modification
GO:0032502	0.399	developmental process
GO:0048856	0.394	anatomical structure development
GO:0044093	0.385	positive regulation of molecular function
GO:0048519	0.348	negative regulation of biological process
GO:0048523	0.339	negative regulation of cellular process
GO:0007275	0.330	multicellular organism development
GO:0051179	0.326	localization
GO:0050790	0.318	regulation of catalytic activity
GO:0048583	0.303	regulation of response to stimulus
GO:0051246	0.303	regulation of protein metabolic process
GO:0019220	0.302	regulation of phosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0071944	0.995	cell periphery
GO:0005737	0.994	cytoplasm
GO:0005634	0.986	nucleus
GO:0070013	0.979	intracellular organelle lumen
GO:0005654	0.966	nucleoplasm
GO:0005886	0.964	plasma membrane
GO:0005829	0.941	cytosol
GO:0043232	0.782	intracellular non-membrane-bounded organelle
GO:0030054	0.697	cell junction
GO:0005856	0.627	cytoskeleton
GO:0031982	0.365	vesicle
GO:0045202	0.351	synapse
GO:0065010	0.338	extracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.26	0.987	[tau protein] kinase.

[back to server]