StarFunc result for job id Q7KZN9

User Input

>input (410 residues)
MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSL
PSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAE
FQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGM
KGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWT
SLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESW
IPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVTL
LALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BJ03	0.898	0.891	9.969E-48	413	0.902	0.896	Q8BJ03.pdb.gz	COX15_MOUSE Cytochrome c oxidase assembly protein COX15 homolog OS=Mus musculus OX=10090 GN=Cox15 PE=1 SV=1
2	AFDB:Q9FKT8	0.806	0.725	7.407E-27	457	0.400	0.359	Q9FKT8.pdb.gz	COX15_ARATH Cytochrome c oxidase assembly protein COX15 OS=Arabidopsis thaliana OX=3702 GN=COX15 PE=2 SV=1
3	AFDB:A0A1D8PPE8	0.813	0.699	3.976E-26	479	0.420	0.359	A0A1D8PPE8.pdb.gz	A0A1D8PPE8_CANAL Cox15p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX15 PE=3 SV=1
4	AFDB:P40086	0.776	0.658	4.905E-26	486	0.390	0.329	P40086.pdb.gz	COX15_YEAST Cytochrome c oxidase assembly protein COX15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX15 PE=1 SV=1
5	AFDB:Q10361	0.781	0.524	7.215E-25	616	0.410	0.273	Q10361.pdb.gz	ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=etp1 PE=1 SV=2
6	AFDB:P12946	0.571	0.748	7.026E-7	306	0.132	0.176	P12946.pdb.gz	CTAA_BACSU Heme A synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=ctaA PE=1 SV=1
7	PDB:6a2jA	0.551	0.714	5.456E-6	309	0.134	0.178	6a2jA.pdb.gz	Crystal structure of heme A synthase fromBacillus subtilis.
8	AFDB:W0SKS3	0.278	0.282	2.072E-2	400	0.115	0.117	W0SKS3.pdb.gz	U6DT_PETCR Umbelliferone 6-dimethylallyltransferase, chloroplastic OS=Petroselinum crispum OX=4043 GN=PcPT PE=1 SV=1
9	AFDB:Q0WUA3	0.185	0.194	5.222E-2	382	0.151	0.162	Q0WUA3.pdb.gz	MENA_ARATH 2-carboxy-1,4-naphthoquinone phytyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC4 PE=1 SV=2
10	AFDB:Q5BI62	0.143	0.062	6.719E-2	1313	0.105	0.033	Q5BI62.pdb.gz	Q5BI62_DROME LP14331p OS=Drosophila melanogaster OX=7227 GN=Mdr50 PE=1 SV=1
11	AFDB:Q9M3B9	0.145	0.061	6.719E-2	1408	0.129	0.038	Q9M3B9.pdb.gz	AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana OX=3702 GN=ABCB20 PE=1 SV=1
12	PDB:1w07B	0.129	0.095	2.070E-1	658	0.122	0.076	1w07B.pdb.gz	Acyl-Coa Oxidase 1 from Arabidopsis Thaliana. Structure of a Key Enzyme in Plant Lipid Metabolism
13	PDB:4f4cA	0.165	0.077	3.287E-1	1250	0.112	0.037	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
14	PDB:6x15A	0.117	0.115	3.728E-1	419	0.122	0.119	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
15	PDB:7nsgA	0.126	0.122	4.229E-1	430	0.112	0.107	7nsgA.pdb.gz	Structure of human excitatory amino acid transporter 3 (EAAT3) in complex with HIP-B
16	PDB:5k3iA	0.155	0.112	4.410E-1	661	0.117	0.073	5k3iA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.
17	PDB:7mitE	0.129	0.053	5.674E-1	1438	0.102	0.029	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
18	PDB:5k3hB	0.131	0.097	5.918E-1	635	0.102	0.066	5k3hB.pdb.gz
19	PDB:4iu8B	0.190	0.185	7.614E-1	427	0.127	0.122	4iu8B.pdb.gz	Structure and mechanism of a nitrate transporter.
20	PDB:5k3jA	0.130	0.091	7.941E-1	662	0.088	0.054	5k3jA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7KZN9	0.0	834	410	1.000	1.000	COX15_HUMAN Cytochrome c oxidase assembly protein COX15 homolog OS=Homo sapiens OX=9606 GN=COX15 PE=1 SV=1
2	Q8BJ03	0.0	728	413	0.905	0.898	COX15_MOUSE Cytochrome c oxidase assembly protein COX15 homolog OS=Mus musculus OX=10090 GN=Cox15 PE=1 SV=1
3	Q9FKT8	5.88e-102	312	457	0.380	0.341	COX15_ARATH Cytochrome c oxidase assembly protein COX15 OS=Arabidopsis thaliana OX=3702 GN=COX15 PE=2 SV=1
4	A0A1D8PPE8	6.06e-83	263	479	0.398	0.340	A0A1D8PPE8_CANAL Cox15p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX15 PE=3 SV=1
5	P40086	3.64e-81	259	486	0.371	0.313	COX15_YEAST Cytochrome c oxidase assembly protein COX15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX15 PE=1 SV=1
6	Q10361	1.89e-80	261	616	0.398	0.265	ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=etp1 PE=1 SV=2
7	P03316	3.8	32.3	1245	0.063	0.021	POLS_SINDV Structural polyprotein OS=Sindbis virus OX=11034 PE=1 SV=1
8	P76249	3.8	31.6	212	0.066	0.127	LEUE_ECOLI Leucine efflux protein OS=Escherichia coli (strain K12) OX=83333 GN=leuE PE=1 SV=1
9	Q05793	4.5	32.3	3707	0.068	0.008	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
10	P03315	6.1	31.6	1253	0.059	0.019	POLS_SFV Structural polyprotein OS=Semliki forest virus OX=11033 PE=1 SV=1
11	F1MWM0	6.5	31.6	2281	0.044	0.008	ABCA4_BOVIN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Bos taurus OX=9913 GN=ABCA4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02628 COX15-CtaA	6.6e-108	372.2	Cytochrome oxidase assembly protein
2	PF19728 DUF6220	3.5	19.3	Family of unknown function (DUF6220)
3	PF00944 Peptidase_S3	2.9e+02	12.7	Alphavirus core protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000016171

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261643	0.997	Protoheme IX farnesyltransferase, mitochondrial
2	9606.ENSP00000361042	0.984	Surfeit locus protein 1
3	9606.ENSP00000354499	0.962	Cytochrome c oxidase subunit 1
4	9606.ENSP00000255390	0.960	Protein SCO1 homolog, mitochondrial
5	9606.ENSP00000317780	0.954	Cytochrome c oxidase subunit 5A, mitochondrial
6	9606.ENSP00000354982	0.953	Cytochrome c oxidase subunit 3
7	9606.ENSP00000317159	0.949	Cytochrome c1, heme protein, mitochondrial
8	9606.ENSP00000354876	0.938	Cytochrome c oxidase subunit 2
9	9606.ENSP00000299335	0.924	Cytochrome c oxidase assembly protein COX11, mitochondrial
10	9606.ENSP00000246554	0.900	Cytochrome c oxidase subunit 6B1
11	9606.ENSP00000444433	0.894	Protein SCO2 homolog, mitochondrial
12	9606.ENSP00000268379	0.881	Cytochrome b-c1 complex subunit 2, mitochondrial
13	9606.ENSP00000258975	0.878	Translational activator of cytochrome c oxidase 1
14	9606.ENSP00000287490	0.877	Cytochrome c oxidase subunit 6A2, mitochondrial
15	9606.ENSP00000413908	0.877	Mitochondrial chaperone BCS1
16	9606.ENSP00000229379	0.873	Cytochrome c oxidase subunit 6A1, mitochondrial
17	9606.ENSP00000457513	0.860	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
18	9606.ENSP00000261070	0.859	Cytochrome c oxidase copper chaperone
19	9606.ENSP00000339720	0.858	Cytochrome c oxidase subunit NDUFA4
20	9606.ENSP00000354762	0.857	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004129	1.000	cytochrome-c oxidase activity
GO:0060090	0.999	molecular adaptor activity
GO:0005515	0.999	protein binding
GO:0016627	0.999	oxidoreductase activity, acting on the CH-CH group of donors
GO:0020037	0.999	heme binding
GO:0016651	0.918	oxidoreductase activity, acting on NAD(P)H

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0045333	0.991	cellular respiration
GO:0071840	0.987	cellular component organization or biogenesis
GO:0006119	0.979	oxidative phosphorylation
GO:0008535	0.975	respiratory chain complex IV assembly
GO:0022904	0.970	respiratory electron transport chain
GO:0071704	0.961	organic substance metabolic process
GO:0019646	0.955	aerobic electron transport chain
GO:0042168	0.898	heme metabolic process
GO:0019438	0.886	aromatic compound biosynthetic process
GO:0018130	0.886	heterocycle biosynthetic process
GO:0046148	0.880	pigment biosynthetic process
GO:0044271	0.880	cellular nitrogen compound biosynthetic process
GO:1901362	0.878	organic cyclic compound biosynthetic process
GO:1901566	0.877	organonitrogen compound biosynthetic process
GO:0033014	0.872	tetrapyrrole biosynthetic process
GO:0006779	0.850	porphyrin-containing compound biosynthetic process
GO:0006783	0.825	heme biosynthetic process
GO:0051179	0.593	localization
GO:0006810	0.571	transport
GO:0042773	0.522	ATP synthesis coupled electron transport
GO:0006812	0.457	monoatomic cation transport
GO:0098660	0.456	inorganic ion transmembrane transport
GO:0034220	0.455	monoatomic ion transmembrane transport
GO:1902600	0.445	proton transmembrane transport
GO:0032501	0.400	multicellular organismal process
GO:0042775	0.364	mitochondrial ATP synthesis coupled electron transport
GO:0006784	0.301	heme A biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	1.000	mitochondrial inner membrane
GO:0070013	0.966	intracellular organelle lumen
GO:0032991	0.961	protein-containing complex
GO:1902494	0.881	catalytic complex
GO:0005634	0.853	nucleus
GO:0005746	0.837	mitochondrial respirasome
GO:0005654	0.813	nucleoplasm
GO:0098803	0.466	respiratory chain complex
GO:0070069	0.456	cytochrome complex
GO:0098798	0.448	mitochondrial protein-containing complex
GO:0098800	0.396	inner mitochondrial membrane protein complex
GO:0005759	0.325	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11436	1.000	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	1.000	cytochrome-c oxidase.
EC:1.3.-.-	0.999	Acting on the CH-CH group of donors.
EC:1.6.-.-	0.918	Acting on NADH or NADPH.

[back to server]