StarFunc result for job id Q7L014

User Input

>input (1031 residues)
MGRESRHYRKRSASRGRSGSRSRSRSPSDKRSKRGDDRRSRSRDRDRRRERSRSRDKRRS
RSRDRKRLRRSRSRERDRSRERRRSRSRDRRRSRSRSRGRRSRSSSPGNKSKKTENRSRS
KEKTDGGESSKEKKKDKDDKEDEKEKDAGNFDQNKLEEEMRKRKERVEKWREEQRKKAME
NIGELKKEIEEMKQGKKWSLEDDDDDEDDPAEAEKEGNEMEGEELDPLDAYMEEVKEEVK
KFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAMEYSSEEEE
VDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGI
TVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGS
GKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVY
GGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFE
PQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVI
EEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDS
IINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAY
TFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKF
DETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPA
PTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQL
AEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISE
YSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSY
QPTNKGRYKVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DG89	0.475	0.474	0.000	1032	1.000	0.999	A0A0C4DG89.pdb.gz	A0A0C4DG89_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=1
2	PDB:7evoE	0.225	0.494	4.799E-57	455	0.439	0.996	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
3	AFDB:P24783	0.406	0.760	1.313E-52	546	0.199	0.375	P24783.pdb.gz	DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP2 PE=1 SV=1
4	PDB:7evnE	0.243	0.513	2.332E-45	486	0.208	0.440	7evnE.pdb.gz	Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
5	AFDB:Q8H136	0.388	0.637	4.295E-45	619	0.186	0.310	Q8H136.pdb.gz	RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana OX=3702 GN=RH14 PE=1 SV=2
6	AFDB:Q580H2	0.413	0.735	5.385E-43	569	0.186	0.337	Q580H2.pdb.gz	Q580H2_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.160 PE=3 SV=1
7	AFDB:Q5W5U4	0.388	0.542	4.553E-42	729	0.202	0.285	Q5W5U4.pdb.gz	DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus OX=9913 GN=DDX4 PE=2 SV=1
8	PDB:7oqbp	0.254	0.580	4.103E-41	444	0.177	0.412	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
9	AFDB:A0A024R0Z3	0.368	0.456	5.709E-40	820	0.254	0.320	A0A024R0Z3.pdb.gz
10	AFDB:P20447	0.395	0.763	6.039E-40	523	0.166	0.327	P20447.pdb.gz	DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP3 PE=1 SV=2
11	AFDB:Q9N5K1	0.394	0.627	1.002E-38	630	0.172	0.281	Q9N5K1.pdb.gz	Q9N5K1_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=sacy-1 PE=1 SV=1
12	AFDB:Q10202	0.386	0.671	1.003E-37	578	0.165	0.294	Q10202.pdb.gz	DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp3 PE=3 SV=1
13	AFDB:Q96GQ7	0.348	0.447	8.498E-34	796	0.164	0.212	Q96GQ7.pdb.gz	DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2
14	PDB:6qw65X	0.249	0.421	6.120E-32	583	0.173	0.305	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:3ex7C	0.343	0.875	6.853E-31	392	0.123	0.324	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
16	PDB:7pliA	0.336	0.740	3.497E-29	457	0.125	0.282	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
17	PDB:7pq0B	0.213	0.539	7.679E-29	385	0.117	0.314	7pq0B.pdb.gz
18	PDB:1fuuB	0.202	0.531	4.910E-26	380	0.108	0.292	1fuuB.pdb.gz
19	PDB:5zwny	0.196	0.488	4.914E-25	399	0.124	0.321	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
20	PDB:7oi6x	0.335	0.898	8.159E-23	374	0.107	0.294	7oi6x.pdb.gz	A distinct assembly pathway of the human 39S late pre-mitoribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG89	0.0	2102	1032	1.000	0.999	A0A0C4DG89_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=1
2	D6RJA6	0.0	696	471	0.383	0.839	D6RJA6_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=1
3	Q62780	0.0	2079	1032	0.987	0.986	DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus OX=10116 GN=Ddx46 PE=1 SV=1
4	Q7L014	0.0	2106	1031	1.000	1.000	DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2
5	Q95TU3	0.0	671	680	0.317	0.481	Q95TU3_DROME LD21880p OS=Drosophila melanogaster OX=7227 GN=Prp5 PE=2 SV=1
6	Q9P7C7	0.0	702	1014	0.428	0.435	PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp11 PE=1 SV=1
7	Q9VXW2	0.0	849	1224	0.412	0.347	Q9VXW2_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Prp5 PE=1 SV=1
8	Q8W4R3	2.17e-130	409	591	0.191	0.333	RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana OX=3702 GN=RH30 PE=1 SV=2
9	Q86XP3	2.49e-127	412	938	0.212	0.233	DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 PE=1 SV=1
10	P24782	2.81e-121	384	550	0.192	0.360	DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp2 PE=2 SV=2
11	P24783	1.13e-120	382	546	0.187	0.353	DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP2 PE=1 SV=1
12	Q6NWH7	3.02e-118	374	496	0.181	0.377	Q6NWH7_DANRE RNA helicase OS=Danio rerio OX=7955 GN=wu:fa56a07 PE=1 SV=1
13	Q501J6	3.41e-117	377	650	0.187	0.297	DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus OX=10090 GN=Ddx17 PE=1 SV=1
14	F1Q5L6	1.51e-116	374	617	0.180	0.301	F1Q5L6_DANRE RNA helicase OS=Danio rerio OX=7955 GN=wu:fa56a07 PE=1 SV=1
15	Q92841	1.06e-115	375	729	0.187	0.265	DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2
16	A0A1X7SBZ2	1.10e-115	375	729	0.187	0.265	A0A1X7SBZ2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=1
17	A0A5H1ZRQ2	1.11e-115	375	731	0.187	0.264	A0A5H1ZRQ2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2
18	Q6AYI1	1.13e-115	371	615	0.174	0.291	Q6AYI1_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
19	B6DTP5	1.66e-115	371	614	0.174	0.292	B6DTP5_RAT Probable ATP-dependent RNA helicase DDX5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=2 SV=1
20	Q61656	1.82e-115	371	614	0.173	0.290	DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus OX=10090 GN=Ddx5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06153 CdAMP_rec	1.8e+02	13.7	Cyclic-di-AMP receptor
2	PF00270 DEAD	1.5e-47	173.2	DEAD/DEAH box helicase
3	PF00271 Helicase_C	4.5e-24	96.3	Helicase conserved C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000029506

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000017387	0.991	Splicing factor 3a, subunit 2, 66kDa
2	9598.ENSPTRP00000018174	0.988	Uncharacterized protein
3	9598.ENSPTRP00000021823	0.984	Splicing factor 3b, subunit 1, 155kDa
4	9598.ENSPTRP00000029697	0.976	Uncharacterized protein
5	9598.ENSPTRP00000000980	0.975	Pan troglodytes splicing factor 3a, subunit 3, 60kDa (SF3A3), mRNA
6	9598.ENSPTRP00000006745	0.968	Splicing factor 3b, subunit 2, 145kDa
7	9598.ENSPTRP00000049734	0.966	Splicing factor 3a, subunit 1, 120kDa
8	9598.ENSPTRP00000011043	0.959	RNA binding motif protein 25
9	9598.ENSPTRP00000024852	0.945	PHD finger protein 5A
10	9598.ENSPTRP00000014195	0.937	Splicing factor 3b, subunit 3, 130kDa
11	9598.ENSPTRP00000002107	0.936	Splicing factor 3b, subunit 4, 49kDa
12	9598.ENSPTRP00000011974	0.931	Pan troglodytes microfibrillar-associated protein 1 (MFAP1), mRNA
13	9598.ENSPTRP00000031872	0.923	Splicing factor 3b, subunit 5, 10kDa
14	9598.ENSPTRP00000041754	0.904	Small nuclear ribonucleoprotein polypeptide A
15	9598.ENSPTRP00000027472	0.900	DEAH (Asp-Glu-Ala-His) box polypeptide 15
16	9598.ENSPTRP00000038444	0.900	Uncharacterized protein
17	9598.ENSPTRP00000022762	0.894	Small nuclear ribonucleoprotein polypeptide B
18	9598.ENSPTRP00000051301	0.894	Small nuclear ribonucleoprotein polypeptide E
19	9598.ENSPTRP00000020111	0.885	Splicing factor 3B, 14 kDa subunit
20	9598.ENSPTRP00000024409	0.861	Small nuclear ribonucleoprotein D3 polypeptide 18kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0140657	0.927	ATP-dependent activity
GO:0003824	0.901	catalytic activity
GO:0004386	0.893	helicase activity
GO:0008186	0.841	ATP-dependent activity, acting on RNA
GO:0140098	0.830	catalytic activity, acting on RNA
GO:0003724	0.822	RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006396	0.989	RNA processing
GO:0008380	0.978	RNA splicing
GO:0006397	0.977	mRNA processing
GO:0000398	0.966	mRNA splicing, via spliceosome
GO:0065007	0.726	biological regulation
GO:0050789	0.605	regulation of biological process
GO:0050794	0.420	regulation of cellular process
GO:0019222	0.333	regulation of metabolic process
GO:0060255	0.324	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.973	nucleolus
GO:0016607	0.970	nuclear speck
GO:0001650	0.887	fibrillar center
GO:0032991	0.655	protein-containing complex
GO:0005737	0.461	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.822	RNA helicase.

[back to server]