StarFunc result for job id Q7L0Q8

User Input

>input (258 residues)
MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAV
GKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTN
TDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKE
KPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSRTP
DKMKNLSKSWWKKYCCFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EQT3	0.773	0.765	4.185E-46	261	0.919	0.908	Q9EQT3.pdb.gz	RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus OX=10090 GN=Rhou PE=2 SV=1
2	AFDB:Q5U3T8	0.737	0.748	5.916E-37	254	0.729	0.740	Q5U3T8.pdb.gz	Q5U3T8_DANRE Ras homolog family member Ua OS=Danio rerio OX=7955 GN=zgc:101642 PE=2 SV=1
3	AFDB:Q96L33	0.726	0.793	1.011E-31	236	0.500	0.547	Q96L33.pdb.gz	RHOV_HUMAN Rho-related GTP-binding protein RhoV OS=Homo sapiens OX=9606 GN=RHOV PE=1 SV=1
4	AFDB:Q5YLG6	0.719	0.789	3.147E-31	235	0.457	0.502	Q5YLG6.pdb.gz	Q5YLG6_DANRE Novel protein similar to vertebrate ras homolog gene family, member V (RHOV) OS=Danio rerio OX=7955 GN=OTTDARP00000007023 PE=2 SV=1
5	AFDB:A0JC80	0.677	0.875	7.853E-30	199	0.438	0.568	A0JC80.pdb.gz	A0JC80_9HYPO RacA OS=Epichloe festucae OX=35717 GN=racA PE=2 SV=1
6	AFDB:A2QFE0	0.693	0.927	1.899E-29	192	0.395	0.531	A2QFE0.pdb.gz	A2QFE0_ASPNC Cell division control protein 42 homolog OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An02g14200 PE=3 SV=1
7	AFDB:Q4WWL5	0.686	0.884	2.604E-29	199	0.426	0.553	Q4WWL5.pdb.gz	Q4WWL5_ASPFU Rho GTPase Rac, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G06300 PE=4 SV=1
8	AFDB:Q05062	0.682	0.919	2.773E-29	191	0.426	0.576	Q05062.pdb.gz	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
9	AFDB:P0CY33	0.677	0.913	4.049E-29	191	0.395	0.534	P0CY33.pdb.gz	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
10	AFDB:P40793	0.679	0.916	5.211E-29	191	0.430	0.581	P40793.pdb.gz	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
11	PDB:1nf3A	0.683	0.905	5.742E-27	194	0.419	0.557	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
12	PDB:6hxuA	0.681	0.960	1.433E-25	182	0.322	0.456	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
13	PDB:2wkpA	0.663	0.536	3.692E-25	320	0.395	0.319	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
14	PDB:5c2kA	0.691	0.469	3.932E-25	382	0.326	0.220	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	PDB:6ukaA	0.663	0.961	5.741E-25	177	0.353	0.514	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
16	PDB:6jikA	0.678	0.955	6.115E-25	182	0.314	0.445	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
17	PDB:4mitC	0.684	0.971	8.928E-25	181	0.314	0.448	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
18	PDB:2atxA	0.676	0.930	8.650E-24	186	0.380	0.527	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
19	PDB:3a58F	0.675	0.957	7.869E-23	181	0.302	0.431	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
20	PDB:2j0vB	0.611	0.843	2.092E-21	184	0.345	0.484	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L0Q8	0.0	528	258	1.000	1.000	RHOU_HUMAN Rho-related GTP-binding protein RhoU OS=Homo sapiens OX=9606 GN=RHOU PE=1 SV=1
2	Q9EQT3	3.03e-145	409	261	0.884	0.874	RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus OX=10090 GN=Rhou PE=2 SV=1
3	Q5U3T8	4.47e-129	367	254	0.674	0.685	Q5U3T8_DANRE Ras homolog family member Ua OS=Danio rerio OX=7955 GN=zgc:101642 PE=2 SV=1
4	Q9Z1Y0	4.91e-89	265	236	0.500	0.547	RHOV_RAT Rho-related GTP-binding protein RhoV OS=Rattus norvegicus OX=10116 GN=Rhov PE=1 SV=1
5	Q96L33	2.05e-88	263	236	0.496	0.542	RHOV_HUMAN Rho-related GTP-binding protein RhoV OS=Homo sapiens OX=9606 GN=RHOV PE=1 SV=1
6	Q5YLG6	2.92e-78	238	235	0.492	0.540	Q5YLG6_DANRE Novel protein similar to vertebrate ras homolog gene family, member V (RHOV) OS=Danio rerio OX=7955 GN=OTTDARP00000007023 PE=2 SV=1
7	Q52WY2	2.66e-76	231	191	0.419	0.565	Q52WY2_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
8	P60766	4.69e-76	231	191	0.426	0.576	CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus OX=10090 GN=Cdc42 PE=1 SV=2
9	P60953	4.69e-76	231	191	0.426	0.576	CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2
10	Q8CFN2	4.69e-76	231	191	0.426	0.576	CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus OX=10116 GN=Cdc42 PE=1 SV=2
11	Q6PFU4	1.49e-75	229	191	0.411	0.555	Q6PFU4_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
12	Q05062	7.09e-75	228	191	0.426	0.576	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
13	A0JC80	1.61e-74	227	199	0.434	0.563	A0JC80_9HYPO RacA OS=Epichloe festucae OX=35717 GN=racA PE=2 SV=1
14	P40793	1.72e-74	226	191	0.407	0.550	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
15	Q5DR84	1.18e-72	222	199	0.415	0.538	Q5DR84_ASPNG CorA-like Mg2+ transporter family protein OS=Aspergillus niger OX=5061 GN=AnigIFM60653_002925 PE=4 SV=1
16	Q4WWL5	1.68e-72	222	199	0.415	0.538	Q4WWL5_ASPFU Rho GTPase Rac, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G06300 PE=4 SV=1
17	Q03206	2.32e-72	221	191	0.415	0.560	RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans OX=6239 GN=ced-10 PE=1 SV=2
18	Q24814	1.37e-71	219	196	0.415	0.546	RACA_ENTH1 Rho-related protein racA OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=RACA PE=1 SV=1
19	P62998	8.58e-71	217	192	0.403	0.542	RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1
20	P63000	8.58e-71	217	192	0.403	0.542	RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.5e+02	13.4	AAA ATPase domain
2	PF12775 AAA_7	5e+02	11.6	P-loop containing dynein motor region
3	PF02230 Abhydrolase_2	5.7e+02	11.7	Phospholipase/Carboxylesterase
4	PF00025 Arf	0.36	21.8	ADP-ribosylation factor family
5	PF14606 Lipase_GDSL_3	2.3e+02	13.2	GDSL-like Lipase/Acylhydrolase family
6	PF00071 Ras	2.8e-46	168.6	Ras family
7	PF08477 Roc	5.3e-17	73.5	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355652

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451828	0.963	RAC-alpha serine/threonine-protein kinase
2	9606.ENSP00000371798	0.927	Fascin
3	9606.ENSP00000380638	0.926	Protein-tyrosine kinase 2-beta
4	9606.ENSP00000233154	0.925	Cytoplasmic protein NCK2
5	9606.ENSP00000264657	0.916	Signal transducer and activator of transcription 3
6	9606.ENSP00000446007	0.913	Vimentin
7	9606.ENSP00000428056	0.912	Phosphatidylinositol 3-kinase regulatory subunit alpha
8	9606.ENSP00000335153	0.910	Heat shock protein HSP 90-alpha
9	9606.ENSP00000354394	0.908	Signal transducer and activator of transcription 1-alpha/beta
10	9606.ENSP00000384849	0.905	Cyclin-dependent kinase inhibitor 1
11	9606.ENSP00000370343	0.904	Interferon regulatory factor 4
12	9606.ENSP00000330341	0.903	Suppressor of cytokine signaling 3
13	9606.ENSP00000327251	0.900	Nitric oxide synthase, inducible
14	9606.ENSP00000358022	0.900	Induced myeloid leukemia cell differentiation protein Mcl-1
15	9606.ENSP00000469413	0.898	Serine/threonine-protein kinase PAK 4
16	9606.ENSP00000376345	0.890	Growth factor receptor-bound protein 2
17	9606.ENSP00000278568	0.884	Serine/threonine-protein kinase PAK 1
18	9606.ENSP00000269321	0.851	Rho GDP-dissociation inhibitor 1
19	9606.ENSP00000228945	0.787	Rho GDP-dissociation inhibitor 2
20	9606.ENSP00000267257	0.743	Paxillin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003924	0.987	GTPase activity
GO:0097159	0.878	organic cyclic compound binding
GO:1901363	0.876	heterocyclic compound binding
GO:0098772	0.644	molecular function regulator activity
GO:0019001	0.579	guanyl nucleotide binding
GO:0032561	0.565	guanyl ribonucleotide binding
GO:0043168	0.531	anion binding
GO:0005525	0.521	GTP binding
GO:0030234	0.505	enzyme regulator activity
GO:0019899	0.475	enzyme binding
GO:0140677	0.470	molecular function activator activity
GO:0030695	0.319	GTPase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0050896	0.978	response to stimulus
GO:0016043	0.964	cellular component organization
GO:0051716	0.952	cellular response to stimulus
GO:0048518	0.934	positive regulation of biological process
GO:0008360	0.926	regulation of cell shape
GO:0048522	0.917	positive regulation of cellular process
GO:0048583	0.881	regulation of response to stimulus
GO:0006996	0.860	organelle organization
GO:0007010	0.850	cytoskeleton organization
GO:0007165	0.836	signal transduction
GO:0023051	0.811	regulation of signaling
GO:0010646	0.810	regulation of cell communication
GO:0030029	0.798	actin filament-based process
GO:0030036	0.788	actin cytoskeleton organization
GO:0009966	0.775	regulation of signal transduction
GO:0032386	0.726	regulation of intracellular transport
GO:0032880	0.682	regulation of protein localization
GO:1903747	0.607	regulation of establishment of protein localization to mitochondrion
GO:1902531	0.557	regulation of intracellular signal transduction
GO:0033157	0.548	regulation of intracellular protein transport
GO:0032501	0.396	multicellular organismal process
GO:0048519	0.337	negative regulation of biological process
GO:1903829	0.324	positive regulation of protein localization
GO:1903533	0.307	regulation of protein targeting
GO:0051128	0.303	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0012505	0.990	endomembrane system
GO:0031982	0.962	vesicle
GO:0031410	0.951	cytoplasmic vesicle
GO:0031090	0.874	organelle membrane
GO:0098588	0.781	bounding membrane of organelle
GO:0012506	0.509	vesicle membrane
GO:0005768	0.493	endosome
GO:0030659	0.491	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.987	GTP + H2O = GDP + H(+) + phosphate

[back to server]