StarFunc result for job id Q7L0X0

User Input

>input (811 residues)
MEAARALRLLLVVCGCLALPPLAEPVCPERCDCQHPQHLLCTNRGLRVVPKTSSLPSPHD
VLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQ
ALAPGTLAPLRKLRILYANGNEISRLSRGSFEGLESLVKLRLDGNALGALPDAVFAPLGN
LLYLHLESNRIRFLGKNAFAQLGKLRFLNLSANELQPSLRHAATFAPLRSLSSLILSANN
LQHLGPRIFQHLPRLGLLSLRGNQLTHLAPEAFWGLEALRELRLEGNRLSQLPTALLEPL
HSLEALDLSGNELSALHPATFGHLGRLRELSLRNNALSALSGDIFAASPALYRLDLDGNG
WTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQQLQNGSCADPSPS
ASLTADRRRQPLPTAAGEEMTPPAGLAEELPPQPQLQQQGRFLAGVAWDGAARELVGNRS
ALRLSRRGPGLQQPSPSVAAAAGPAPQSLDLHKKPQRGRPTRADPALAEPTPTASPGSAP
SPAGDPWQRATKHRLGTEHQERAAQSDGGAGLPPLVSDPCDFNKFILCNLTVEAVGADSA
SVRWAVREHRSPRPLGGARFRLLFDRFGQQPKFHRFVYLPESSDSATLRELRGDTPYLVC
VEGVLGGRVCPVAPRDHCAGLVTLPEAGSRGGVDYQLLTLALLTVNALLVLLALAAWASR
WLRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGVSADFSGFQSHRPRTTVCALSEADLI
EFPCDRFMDSAGGGAGGSLRREDRLLQRFAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L0X0	1.000	1.000	0.000	811	1.000	1.000	Q7L0X0.pdb.gz	TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens OX=9606 GN=TRIL PE=1 SV=2
2	AFDB:P40197	0.400	0.553	6.393E-23	560	0.168	0.243	P40197.pdb.gz	GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens OX=9606 GN=GP5 PE=1 SV=1
3	AFDB:Q8TF66	0.413	0.556	6.708E-23	581	0.174	0.243	Q8TF66.pdb.gz	LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens OX=9606 GN=LRRC15 PE=1 SV=2
4	AFDB:O75094	0.237	0.129	4.402E-21	1523	0.147	0.078	O75094.pdb.gz	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
5	AFDB:Q8CBC6	0.417	0.475	3.481E-20	707	0.200	0.229	Q8CBC6.pdb.gz	LRRN3_MOUSE Leucine-rich repeat neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrn3 PE=2 SV=1
6	AFDB:Q61809	0.428	0.481	9.557E-20	716	0.195	0.221	Q61809.pdb.gz	LRRN1_MOUSE Leucine-rich repeat neuronal protein 1 OS=Mus musculus OX=10090 GN=Lrrn1 PE=2 SV=1
7	AFDB:O08742	0.405	0.557	1.104E-19	567	0.160	0.229	O08742.pdb.gz	GPV_MOUSE Platelet glycoprotein V OS=Mus musculus OX=10090 GN=Gp5 PE=1 SV=1
8	AFDB:A8BB35	0.344	0.586	6.580E-18	445	0.144	0.263	A8BB35.pdb.gz
9	AFDB:A1Z9N6	0.293	0.232	7.975E-18	1092	0.162	0.120	A1Z9N6.pdb.gz	A1Z9N6_DROME Acid labile subunit OS=Drosophila melanogaster OX=7227 GN=conv PE=2 SV=2
10	AFDB:Q965M2	0.372	0.346	1.564E-17	881	0.147	0.135	Q965M2.pdb.gz	SMA10_CAEEL Leucine-rich repeats and immunoglobulin-like domains protein sma-10 OS=Caenorhabditis elegans OX=6239 GN=sma-10 PE=1 SV=1
11	PDB:7wv3A	0.219	0.256	1.925E-14	668	0.117	0.142	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
12	PDB:7tvfD	0.349	0.530	1.197E-13	515	0.107	0.169	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
13	PDB:7wrqA	0.186	0.236	3.797E-13	566	0.173	0.247	7wrqA.pdb.gz
14	PDB:1xcdA	0.316	0.762	2.044E-12	305	0.106	0.282	1xcdA.pdb.gz
15	PDB:2ft3F	0.325	0.807	2.361E-12	305	0.112	0.298	2ft3F.pdb.gz
16	PDB:6gffI	0.325	0.461	3.468E-12	551	0.142	0.209	6gffI.pdb.gz
17	PDB:3b2dA	0.153	0.192	2.614E-11	601	0.139	0.188	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:5yq5B	0.320	0.795	6.212E-11	306	0.113	0.301	5yq5B.pdb.gz
19	PDB:6hkwA	0.289	0.700	2.759E-10	306	0.084	0.222	6hkwA.pdb.gz
20	PDB:3t6qA	0.249	0.324	9.179E-10	601	0.120	0.161	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L0X0	0.0	1616	811	1.000	1.000	TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens OX=9606 GN=TRIL PE=1 SV=2
2	P22792	5.02e-43	166	545	0.160	0.239	CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens OX=9606 GN=CPN2 PE=1 SV=3
3	Q8R5M3	5.36e-41	161	578	0.163	0.228	LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1
4	Q9DBB9	1.30e-40	159	547	0.147	0.218	CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus OX=10090 GN=Cpn2 PE=1 SV=2
5	Q7Z2Q7	7.34e-40	158	622	0.155	0.203	LRR70_HUMAN Leucine-rich repeat-containing protein 70 OS=Homo sapiens OX=9606 GN=LRRC70 PE=2 SV=1
6	P35859	1.96e-39	157	603	0.168	0.226	ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus OX=10116 GN=Igfals PE=1 SV=1
7	Q8TF66	6.19e-38	152	581	0.149	0.208	LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens OX=9606 GN=LRRC15 PE=1 SV=2
8	P70389	1.05e-35	145	603	0.165	0.222	ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus OX=10090 GN=Igfals PE=1 SV=1
9	P35858	9.17e-33	137	605	0.131	0.175	ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens OX=9606 GN=IGFALS PE=1 SV=1
10	F1R4D3	4.22e-32	134	542	0.126	0.188	F1R4D3_DANRE Leucine-rich repeat transmembrane neuronal 2 OS=Danio rerio OX=7955 GN=lrrtm2 PE=1 SV=1
11	F1RSS8	4.29e-32	135	735	0.118	0.131	F1RSS8_PIG Relaxin family peptide receptor 2 OS=Sus scrofa OX=9823 GN=RXFP2 PE=4 SV=3
12	D4A7P2	4.00e-31	130	515	0.139	0.219	LRRT2_RAT Leucine-rich repeat transmembrane neuronal protein 2 OS=Rattus norvegicus OX=10116 GN=Lrrtm2 PE=1 SV=1
13	Q8BGA3	5.99e-31	130	515	0.139	0.219	LRRT2_MOUSE Leucine-rich repeat transmembrane neuronal protein 2 OS=Mus musculus OX=10090 GN=Lrrtm2 PE=2 SV=1
14	O43300	7.47e-31	130	516	0.138	0.217	LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRTM2 PE=1 SV=3
15	Q8WXD0	1.95e-30	130	754	0.115	0.123	RXFP2_HUMAN Relaxin receptor 2 OS=Homo sapiens OX=9606 GN=RXFP2 PE=1 SV=1
16	O75325	5.40e-30	129	713	0.144	0.164	LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRN2 PE=2 SV=2
17	Q52KR2	8.44e-30	129	1054	0.163	0.125	LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1
18	O08742	1.32e-29	127	567	0.152	0.217	GPV_MOUSE Platelet glycoprotein V OS=Mus musculus OX=10090 GN=Gp5 PE=1 SV=1
19	P24014	1.71e-29	129	1504	0.154	0.083	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
20	P70193	4.34e-29	127	1091	0.136	0.101	LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus OX=10090 GN=Lrig1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05425 CopD	1.4e+02	14.3	Copper resistance protein D
2	PF00041 fn3	91	14.8	Fibronectin type III domain
3	PF01463 LRRCT	0.02	26.4	Leucine rich repeat C-terminal domain
4	PF00560 LRR_1	3.4e-08	43.7	Leucine Rich Repeat
5	PF12799 LRR_4	1.7e-19	80.8	Leucine Rich repeats (2 copies)
6	PF13306 LRR_5	2.2e-05	35.8	BspA type Leucine rich repeat region (6 copies)
7	PF13855 LRR_8	2.2e-68	237.2	Leucine rich repeat
8	PF14580 LRR_9	1.7e-08	45.7	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363089	0.942	Toll-like receptor 4
2	9606.ENSP00000284818	0.912	Lymphocyte antigen 96
3	9606.ENSP00000304236	0.901	Monocyte differentiation antigen CD14
4	9606.ENSP00000373620	0.730	60 kDa heat shock protein, mitochondrial
5	9606.ENSP00000448059	0.679	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
6	9606.ENSP00000242784	0.674	Telomerase RNA component interacting RNase
7	9606.ENSP00000319756	0.636	Tensin-2
8	9606.ENSP00000358470	0.636	V-set domain-containing T-cell activation inhibitor 1
9	9606.ENSP00000361811	0.610	TP53-target gene 5 protein
10	9606.ENSP00000369407	0.584	Solute carrier family 25 member 35
11	9606.ENSP00000355991	0.539	TRAF3-interacting JNK-activating modulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001530	1.000	lipopolysaccharide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.967	response to stimulus
GO:0048518	0.957	positive regulation of biological process
GO:0031349	0.929	positive regulation of defense response
GO:0045088	0.925	regulation of innate immune response
GO:0050778	0.910	positive regulation of immune response
GO:0045089	0.896	positive regulation of innate immune response
GO:0002218	0.894	activation of innate immune response
GO:0002764	0.886	immune response-regulating signaling pathway
GO:0019222	0.868	regulation of metabolic process
GO:0002221	0.865	pattern recognition receptor signaling pathway
GO:0060255	0.820	regulation of macromolecule metabolic process
GO:0007166	0.764	cell surface receptor signaling pathway
GO:0010468	0.689	regulation of gene expression
GO:0051239	0.641	regulation of multicellular organismal process
GO:0001817	0.573	regulation of cytokine production
GO:0002429	0.493	immune response-activating cell surface receptor signaling pathway
GO:0002220	0.414	innate immune response activating cell surface receptor signaling pathway
GO:0002697	0.380	regulation of immune effector process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0032991	0.971	protein-containing complex
GO:0043226	0.939	organelle
GO:0043235	0.934	receptor complex
GO:0043227	0.795	membrane-bounded organelle
GO:0071944	0.667	cell periphery
GO:0098796	0.543	membrane protein complex
GO:0005886	0.509	plasma membrane
GO:0005622	0.475	intracellular anatomical structure
GO:0043229	0.425	intracellular organelle
GO:0043231	0.386	intracellular membrane-bounded organelle
GO:0046696	0.371	lipopolysaccharide receptor complex
GO:0005737	0.331	cytoplasm
GO:0005576	0.320	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]