StarFunc result for job id Q7L1S5

User Input

>input (443 residues)
MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKY
LRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQA
LSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRS
FLQEFCKKYGGVSHHQSHLFHTVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASS
AYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSY
YHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHWEKVSKLCYPC
LINYDFVGKFETLEEDANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRT
ERQLIYDFYYLDYLMFNYTTPFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L1S5	1.000	1.000	1.531E-71	443	1.000	1.000	Q7L1S5.pdb.gz	CHST9_HUMAN Carbohydrate sulfotransferase 9 OS=Homo sapiens OX=9606 GN=CHST9 PE=2 SV=2
2	AFDB:Q76EC5	0.682	0.731	2.994E-50	413	0.713	0.765	Q76EC5.pdb.gz	CHST9_MOUSE Carbohydrate sulfotransferase 9 OS=Mus musculus OX=10090 GN=Chst9 PE=2 SV=1
3	AFDB:Q9H2A9	0.625	0.653	1.061E-38	424	0.476	0.498	Q9H2A9.pdb.gz	CHST8_HUMAN Carbohydrate sulfotransferase 8 OS=Homo sapiens OX=9606 GN=CHST8 PE=1 SV=2
4	AFDB:Q8BQ86	0.631	0.668	1.367E-38	417	0.472	0.501	Q8BQ86.pdb.gz	CHST8_MOUSE Carbohydrate sulfotransferase 8 OS=Mus musculus OX=10090 GN=Chst8 PE=2 SV=1
5	AFDB:Q7T3S3	0.602	0.752	1.126E-25	352	0.257	0.324	Q7T3S3.pdb.gz	CHSTB_DANRE Carbohydrate sulfotransferase 11 OS=Danio rerio OX=7955 GN=chst11 PE=2 SV=1
6	AFDB:Q9JME2	0.603	0.753	6.653E-25	352	0.260	0.327	Q9JME2.pdb.gz	CHSTB_MOUSE Carbohydrate sulfotransferase 11 OS=Mus musculus OX=10090 GN=Chst11 PE=2 SV=1
7	AFDB:Q8NET6	0.589	0.759	3.148E-23	341	0.237	0.308	Q8NET6.pdb.gz	CHSTD_HUMAN Carbohydrate sulfotransferase 13 OS=Homo sapiens OX=9606 GN=CHST13 PE=1 SV=1
8	AFDB:O43529	0.524	0.647	2.508E-19	356	0.251	0.312	O43529.pdb.gz	CHSTA_HUMAN Carbohydrate sulfotransferase 10 OS=Homo sapiens OX=9606 GN=CHST10 PE=1 SV=1
9	AFDB:Q8NCH0	0.548	0.641	2.638E-19	376	0.233	0.274	Q8NCH0.pdb.gz	CHSTE_HUMAN Carbohydrate sulfotransferase 14 OS=Homo sapiens OX=9606 GN=CHST14 PE=1 SV=2
10	PDB:5t05B	0.270	0.193	5.780E-2	677	0.086	0.056	5t05B.pdb.gz	Structure Based Substrate Specificity Analysis of Heparan Sulfate 6-O-Sulfotransferases.
11	PDB:7eovA	0.213	0.309	9.127E-2	274	0.079	0.128	7eovA.pdb.gz	The crystal structure of mouse SULT2A8 reveals the mechanism of 7 alpha-hydroxyl, bile acid sulfation.
12	PDB:1q44A	0.201	0.283	1.238E-1	284	0.079	0.123	1q44A.pdb.gz
13	PDB:5mekA	0.179	0.232	1.857E-1	322	0.068	0.093	5mekA.pdb.gz	Structural and biochemical studies of sulphotransferase 18 from Arabidopsis thaliana explain its substrate specificity and reaction mechanism.
14	PDB:2ad1A	0.256	0.412	2.056E-1	244	0.054	0.098	2ad1A.pdb.gz
15	PDB:1q1qA	0.207	0.301	2.518E-1	278	0.050	0.079	1q1qA.pdb.gz	Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.
16	PDB:3bfxA	0.263	0.411	2.649E-1	253	0.068	0.119	3bfxA.pdb.gz	Crystal Structures of Human Sulfotransferases Sult1B1 and Sult1C1 Complexed with the Cofactor Product Adenosine-3'-5'-Diphosphate (Pap).
17	AFDB:A0A1D8PRE0	0.082	0.079	2.822E-1	475	0.115	0.107	A0A1D8PRE0.pdb.gz	A0A1D8PRE0_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENP1 PE=3 SV=1
18	PDB:3u3kA	0.168	0.231	3.085E-1	289	0.074	0.114	3u3kA.pdb.gz	The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
19	PDB:2gwhB	0.256	0.362	3.246E-1	288	0.072	0.111	2gwhB.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
20	PDB:1j99A	0.186	0.268	3.780E-1	284	0.081	0.127	1j99A.pdb.gz	Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76EC5	0.0	649	413	0.729	0.782	CHST9_MOUSE Carbohydrate sulfotransferase 9 OS=Mus musculus OX=10090 GN=Chst9 PE=2 SV=1
2	Q7L1S5	0.0	929	443	1.000	1.000	CHST9_HUMAN Carbohydrate sulfotransferase 9 OS=Homo sapiens OX=9606 GN=CHST9 PE=2 SV=2
3	Q9H2A9	2.64e-137	402	424	0.418	0.436	CHST8_HUMAN Carbohydrate sulfotransferase 8 OS=Homo sapiens OX=9606 GN=CHST8 PE=1 SV=2
4	Q8BQ86	9.59e-137	400	417	0.445	0.472	CHST8_MOUSE Carbohydrate sulfotransferase 8 OS=Mus musculus OX=10090 GN=Chst8 PE=2 SV=1
5	Q9JME2	3.23e-64	212	352	0.255	0.321	CHSTB_MOUSE Carbohydrate sulfotransferase 11 OS=Mus musculus OX=10090 GN=Chst11 PE=2 SV=1
6	Q9NPF2	5.74e-64	211	352	0.248	0.312	CHSTB_HUMAN Carbohydrate sulfotransferase 11 OS=Homo sapiens OX=9606 GN=CHST11 PE=1 SV=1
7	Q7T3S3	1.91e-62	207	352	0.246	0.310	CHSTB_DANRE Carbohydrate sulfotransferase 11 OS=Danio rerio OX=7955 GN=chst11 PE=2 SV=1
8	Q8NET6	1.55e-52	181	341	0.237	0.308	CHSTD_HUMAN Carbohydrate sulfotransferase 13 OS=Homo sapiens OX=9606 GN=CHST13 PE=1 SV=1
9	Q9NRB3	1.22e-46	167	414	0.228	0.244	CHSTC_HUMAN Carbohydrate sulfotransferase 12 OS=Homo sapiens OX=9606 GN=CHST12 PE=2 SV=2
10	O54702	1.01e-44	161	356	0.237	0.295	CHSTA_RAT Carbohydrate sulfotransferase 10 OS=Rattus norvegicus OX=10116 GN=Chst10 PE=1 SV=1
11	Q6PGK7	1.96e-44	160	356	0.237	0.295	CHSTA_MOUSE Carbohydrate sulfotransferase 10 OS=Mus musculus OX=10090 GN=Chst10 PE=2 SV=2
12	O43529	2.86e-42	154	356	0.217	0.270	CHSTA_HUMAN Carbohydrate sulfotransferase 10 OS=Homo sapiens OX=9606 GN=CHST10 PE=1 SV=1
13	Q8NCH0	4.62e-40	149	376	0.217	0.255	CHSTE_HUMAN Carbohydrate sulfotransferase 14 OS=Homo sapiens OX=9606 GN=CHST14 PE=1 SV=2
14	O96167	1.2	34.3	994	0.090	0.040	O96167_PLAF7 Serine repeat antigen 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0208000 PE=3 SV=2
15	P25847	1.5	33.9	964	0.043	0.020	MSH2_YEAST DNA mismatch repair protein MSH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSH2 PE=1 SV=2
16	W0TYK3	9.5	30.4	213	0.036	0.075	W0TYK3_ONCMY Caspase 1b (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=casp1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03567 Sulfotransfer_2	2.6e-59	212.9	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480991

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266383	0.915	Beta-1,4-N-acetylgalactosaminyltransferase 3
2	9606.ENSP00000265077	0.907	Versican core protein
3	9606.ENSP00000327336	0.906	Biglycan
4	9606.ENSP00000328277	0.906	N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1
5	9606.ENSP00000052754	0.905	Decorin
6	9606.ENSP00000331210	0.902	Brevican core protein
7	9606.ENSP00000373244	0.902	Chondroitin sulfate proteoglycan 5
8	9606.ENSP00000252575	0.901	Neurocan core protein
9	9606.ENSP00000312506	0.900	Chondroitin sulfate proteoglycan 4
10	9606.ENSP00000366654	0.820	Carbonic anhydrase 6
11	9606.ENSP00000262622	0.815	Carbohydrate sulfotransferase 8
12	9606.ENSP00000309270	0.660	Carbohydrate sulfotransferase 1
13	9606.ENSP00000373370	0.624	Filaggrin-2
14	9606.ENSP00000328983	0.598	Carbohydrate sulfotransferase 6
15	9606.ENSP00000333018	0.583	Tetratricopeptide repeat domain containing
16	9606.ENSP00000276055	0.573	Carbohydrate sulfotransferase 7
17	9606.ENSP00000479069	0.560	SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex)
18	9606.ENSP00000353393	0.557	Coagulation factor VIII
19	9606.ENSP00000381072	0.549	Serpin B8
20	9606.ENSP00000267935	0.533	COMM domain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001537	1.000	N-acetylgalactosamine 4-O-sulfotransferase activity
GO:0047756	0.807	chondroitin 4-sulfotransferase activity
GO:0005488	0.509	binding
GO:0005515	0.498	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0008152	0.985	metabolic process
GO:0009101	0.983	glycoprotein biosynthetic process
GO:0006029	0.967	proteoglycan metabolic process
GO:0006790	0.962	sulfur compound metabolic process
GO:0050654	0.958	chondroitin sulfate proteoglycan metabolic process
GO:1903510	0.950	mucopolysaccharide metabolic process
GO:0030166	0.939	proteoglycan biosynthetic process
GO:0030204	0.922	chondroitin sulfate metabolic process
GO:0006024	0.921	glycosaminoglycan biosynthetic process
GO:0044272	0.901	sulfur compound biosynthetic process
GO:0050650	0.808	chondroitin sulfate proteoglycan biosynthetic process
GO:0065007	0.404	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.2.-	1.000	Sulfotransferases.
RHEA:16101	0.807	n 3'-phosphoadenylyl sulfate + chondroitin beta-D-glucuronate = n adenosine 3',5'-bisphosphate + chondroitin 4'-sulfate + n H(+)
EC:2.8.2.5	0.807	chondroitin 4-sulfotransferase.

[back to server]