StarFunc result for job id Q7L2E3

User Input

>input (1194 residues)
MFSLDSFRKDRAQHRQRQCKLPPPRLPPMCVNPTPGGTISRASRDLLKEFPQPKNLLNSV
IGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQL
FKGWGLLGPRNELFDAAKYRVLADRFGSPADSWWRPEPTMPPTSWRQLNPESIRPGGPGG
LSRSLGREEEEDEEEELEEGTIDVTDFLSMTQQDSHAPLRDSRGSSFEMTDDDSAIRALT
QFPLPKNLLAKVIQIATSSSTAKNLMQFHTVGTKTKLSTLTLLWPCPMTFVAKGRRKAEA
ENKAAALACKKLKSLGLVDRNNEPLTHAMYNLASLRELGETQRRPCTIQVPEPILRKIET
FLNHYPVESSWIAPELRLQSDDILPLGKDSGPLSDPITGKPYVPLLEAEEVRLSQSLLEL
WRRRGPVWQEAPQLPVDPHRDTILNAIEQHPVVVISGDTGCGKTTRIPQLLLERYVTEGR
GARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGFQVRLESKPPSRGGALLFCTVGIL
LRKLQSNPSLEGVSHVIVDEVHERDVNTDFLLILLKGLQRLNPALRLVLMSATGDNERFS
RYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKHQYLHRHRHHESEDECALDLDLVTDLVL
HIDARGEPGGILCFLPGWQEIKGVQQRLQEALGMHESKYLILPVHSNIPMMDQKAIFQQP
PVGVRKIVLATNIAETSITINDIVHVVDSGLHKEERYDLKTKVSCLETVWVSRANVIQRR
GRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRTPLENLVLQAKIHMPEKTAVEFLSKAV
DSPNIKAVDEAVILLQEIGVLDQREYLTTLGQRLAHISTDPRLAKAIVLAAIFRCLHPLL
VVVSCLTRDPFSSSLQNRAEVDKVKALLSHDSGSDHLAFVRAVAGWEEVLRWQDRSSREN
YLEENLLYAPSLRFIHGLIKQFSENIYEAFLVGKPSDCTLASAQCNEYSEEEELVKGVLM
AGLYPNLIQVRQGKVTRQGKFKPNSVTYRTKSGNILLHKSTINREATRLRSRWLTYFMAV
KSNGSVFVRDSSQVHPLAVLLLTDGDVHIRDDGRRATISLSDSDLLRLEGDSRTVRLLKE
LRRALGRMVERSLRSELAALPPSVQEEHGQLLALLAELLRGPCGSFDVRKTADD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99PU8	0.841	0.826	0.000	1217	0.976	0.957	Q99PU8.pdb.gz	DHX30_MOUSE ATP-dependent RNA helicase DHX30 OS=Mus musculus OX=10090 GN=Dhx30 PE=1 SV=1
2	AFDB:F4ILR7	0.598	0.709	1.315E-68	995	0.276	0.331	F4ILR7.pdb.gz	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
3	AFDB:Q05B79	0.566	0.657	1.187E-67	1010	0.272	0.322	Q05B79.pdb.gz	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
4	AFDB:Q28141	0.612	0.571	8.010E-66	1287	0.273	0.253	Q28141.pdb.gz	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
5	AFDB:O70133	0.614	0.536	1.843E-64	1380	0.258	0.223	O70133.pdb.gz	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
6	AFDB:B0S6Z1	0.615	0.579	3.083E-64	1271	0.266	0.250	B0S6Z1.pdb.gz
7	AFDB:Q22307	0.604	0.556	2.418E-63	1301	0.250	0.229	Q22307.pdb.gz	DHX9_CAEEL ATP-dependent RNA helicase A OS=Caenorhabditis elegans OX=6239 GN=rha-1 PE=2 SV=3
8	AFDB:P24785	0.596	0.552	3.055E-63	1293	0.261	0.241	P24785.pdb.gz	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
9	AFDB:F4HYJ6	0.604	0.598	3.201E-63	1206	0.276	0.274	F4HYJ6.pdb.gz	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
10	AFDB:Q6P158	0.589	0.510	3.483E-62	1386	0.290	0.250	Q6P158.pdb.gz	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
11	PDB:5vheA	0.613	0.829	4.646E-60	871	0.251	0.344	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
12	PDB:5n9dB	0.592	0.807	5.008E-58	866	0.224	0.309	5n9dB.pdb.gz	Molecular Mechanistic Insights into Drosophila DHX36-Mediated G-Quadruplex Unfolding: A Structure-Based Model.
13	PDB:5aorA	0.600	0.705	1.928E-56	1009	0.248	0.293	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
14	PDB:7dcpx	0.465	0.803	1.153E-41	670	0.168	0.299	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
15	PDB:6ff7q	0.467	0.860	9.926E-41	625	0.172	0.328	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	PDB:5xjcY	0.469	0.763	7.427E-40	713	0.173	0.289	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
17	PDB:6id1V	0.471	0.824	3.480E-39	663	0.165	0.297	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:3kx2B	0.467	0.722	3.821E-39	755	0.176	0.278	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
19	PDB:5ylzW	0.471	0.779	2.996E-38	703	0.172	0.292	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
20	PDB:6h57A	0.385	0.539	9.653E-38	795	0.176	0.264	6h57A.pdb.gz	The DEAH-box RNA helicase Dhr1 contains a remarkable carboxyl terminal domain essential for small ribosomal subunit biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7BXY3	0.0	2388	1166	0.977	1.000	H7BXY3_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
2	Q5BJS0	0.0	2402	1194	0.977	0.977	DHX30_RAT ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus OX=10116 GN=Dhx30 PE=1 SV=1
3	Q7L2E3	0.0	2447	1194	1.000	1.000	DHX30_HUMAN ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
4	Q99PU8	0.0	2400	1217	0.977	0.958	DHX30_MOUSE ATP-dependent RNA helicase DHX30 OS=Mus musculus OX=10090 GN=Dhx30 PE=1 SV=1
5	Q05B79	3.88e-163	513	1010	0.237	0.280	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
6	Q9H2U1	2.57e-161	508	1008	0.239	0.283	DHX36_HUMAN ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2
7	Q8VHK9	9.37e-160	504	1001	0.252	0.301	DHX36_MOUSE ATP-dependent DNA/RNA helicase DHX36 OS=Mus musculus OX=10090 GN=Dhx36 PE=1 SV=2
8	F4ILR7	3.25e-158	500	995	0.240	0.287	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
9	D4A2Z8	7.36e-157	496	1000	0.248	0.296	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
10	E7EWK3	3.37e-150	473	797	0.219	0.329	E7EWK3_HUMAN RNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=1
11	F4HYJ6	7.34e-144	468	1206	0.240	0.237	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
12	Q8SWT2	4.22e-139	447	942	0.214	0.271	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
13	Q7Z478	1.16e-127	427	1369	0.231	0.202	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
14	Q6PGC1	1.53e-125	421	1365	0.234	0.204	DHX29_MOUSE ATP-dependent RNA helicase DHX29 OS=Mus musculus OX=10090 GN=Dhx29 PE=1 SV=1
15	Q28141	4.35e-125	418	1287	0.218	0.202	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
16	Q08211	7.69e-125	417	1270	0.216	0.203	DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4
17	P24785	7.07e-123	412	1293	0.235	0.217	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
18	O70133	8.56e-118	400	1380	0.209	0.180	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
19	Q382X0	1.63e-109	375	1299	0.222	0.204	Q382X0_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3930 PE=4 SV=1
20	Q583S9	1.37e-104	360	1251	0.209	0.200	Q583S9_TRYB2 ATP-dependent DEAH-box RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.660 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.2e+02	13.6	AAA ATPase domain
2	PF13245 AAA_19	1.4e+02	14.1	AAA domain
3	PF13401 AAA_22	37	16.0	AAA domain
4	PF13476 AAA_23	1.7e+02	14.2	AAA domain
5	PF00005 ABC_tran	5e+02	12.6	ABC transporter
6	PF08096 Bombolitin	4.8e+02	12.5	Bombolitin family
7	PF00270 DEAD	0.0046	28.2	DEAD/DEAH box helicase
8	PF03368 Dicer_dimer	2.2	19.7	Dicer dimerisation domain
9	PF00035 dsrm	0.00034	32.6	Double-stranded RNA binding motif
10	PF04408 HA2	4.8e-09	47.8	Helicase associated domain (HA2)
11	PF00271 Helicase_C	4.2e-10	51.3	Helicase conserved C-terminal domain
12	PF07717 OB_NTP_bind	0.00022	32.9	Oligonucleotide/oligosaccharide-binding (OB)-fold

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405620

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482504	0.861	Photoreceptor-specific nuclear receptor
2	9606.ENSP00000332340	0.807	Probable ATP-dependent RNA helicase DDX28
3	9606.ENSP00000254630	0.798	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
4	9606.ENSP00000254799	0.797	G-rich sequence factor 1
5	9606.ENSP00000465759	0.781	DNA-directed RNA polymerase, mitochondrial
6	9606.ENSP00000264669	0.765	FAST kinase domain-containing protein 3, mitochondrial
7	9606.ENSP00000454836	0.716	Transducin beta-like protein 3
8	9606.ENSP00000260665	0.684	Leucine-rich PPR motif-containing protein, mitochondrial
9	9606.ENSP00000233057	0.682	Interferon-induced, double-stranded RNA-activated protein kinase
10	9606.ENSP00000304226	0.680	Homeodomain-interacting protein kinase 3
11	9606.ENSP00000419665	0.673	Single-stranded DNA-binding protein, mitochondrial
12	9606.ENSP00000382840	0.668	ATP-dependent RNA helicase DDX3X
13	9606.ENSP00000315397	0.657	Mitochondrial ribosomal protein S31
14	9606.ENSP00000258772	0.646	Probable ATP-dependent RNA helicase DDX56
15	9606.ENSP00000366939	0.643	Mitochondrial genome maintenance exonuclease 1
16	9606.ENSP00000248643	0.639	Transcription termination factor 1, mitochondrial
17	9606.ENSP00000481495	0.631	ATP-dependent RNA helicase DDX24
18	9606.ENSP00000301585	0.630	Peptidyl-tRNA hydrolase ICT1, mitochondrial
19	9606.ENSP00000361626	0.622	Nuclease-sensitive element-binding protein 1
20	9606.ENSP00000461945	0.619	Ras-related protein Rab-31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003724	0.999	RNA helicase activity
GO:0003723	0.998	RNA binding
GO:0003725	0.416	double-stranded RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071840	0.987	cellular component organization or biogenesis
GO:0071826	0.964	ribonucleoprotein complex subunit organization
GO:0022618	0.949	ribonucleoprotein complex assembly
GO:0006996	0.898	organelle organization
GO:0042254	0.824	ribosome biogenesis
GO:0042255	0.794	ribosome assembly
GO:0065007	0.755	biological regulation
GO:0050789	0.751	regulation of biological process
GO:0008152	0.609	metabolic process
GO:0071704	0.598	organic substance metabolic process
GO:0044238	0.569	primary metabolic process
GO:0050794	0.568	regulation of cellular process
GO:0006807	0.555	nitrogen compound metabolic process
GO:0044237	0.552	cellular metabolic process
GO:0019222	0.552	regulation of metabolic process
GO:0042273	0.520	ribosomal large subunit biogenesis
GO:0060255	0.515	regulation of macromolecule metabolic process
GO:0043170	0.511	macromolecule metabolic process
GO:0010468	0.452	regulation of gene expression
GO:0034641	0.416	cellular nitrogen compound metabolic process
GO:0031323	0.400	regulation of cellular metabolic process
GO:0006139	0.397	nucleobase-containing compound metabolic process
GO:0051171	0.390	regulation of nitrogen compound metabolic process
GO:0048518	0.371	positive regulation of biological process
GO:0080090	0.370	regulation of primary metabolic process
GO:0090304	0.346	nucleic acid metabolic process
GO:0048522	0.334	positive regulation of cellular process
GO:0019219	0.322	regulation of nucleobase-containing compound metabolic process
GO:0010467	0.316	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0005739	0.989	mitochondrion
GO:0070013	0.982	intracellular organelle lumen
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:0005634	0.799	nucleus
GO:0031981	0.378	nuclear lumen
GO:0005654	0.367	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.999	RNA helicase.

[back to server]