StarFunc result for job id Q7L2Z9

User Input

>input (268 residues)
MSGKANASKKNAQQLKRNPKRKKDNEEVVLSENKVRNTVKKNKNHLKDLSSEGQTKHTNL
KHGKTAASKRKTWQPLSKSTRDHLQTMMESVIMTILSNSIKEKEEIQYHLNFLKKRLLQQ
CETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEIDKMVETTELMTGNIQSLK
NKIQILASEVEEEEERVKQMHQINSSGVLSLPELSQKTLKAPTLQKEILALIPNQNALLK
DLDILHNSSQMKSMSTFIEEAYKKLDAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L2Z9	1.000	1.000	1.384E-37	268	1.000	1.000	Q7L2Z9.pdb.gz	CENPQ_HUMAN Centromere protein Q OS=Homo sapiens OX=9606 GN=CENPQ PE=1 SV=1
2	PDB:7qooQ	0.281	0.355	1.660E-22	209	0.780	1.000	7qooQ.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
3	AFDB:O74844	0.278	0.297	2.617E-3	244	0.142	0.156	O74844.pdb.gz	CENPQ_SCHPO Inner kinetochore subunit fta7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fta7 PE=1 SV=1
4	AFDB:P53298	0.210	0.144	5.769E-3	406	0.142	0.094	P53298.pdb.gz	CENPQ_YEAST Inner kinetochore subunit OKP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OKP1 PE=1 SV=1
5	AFDB:Q8C4M7	0.236	0.169	3.199E-2	410	0.164	0.107	Q8C4M7.pdb.gz	CENPU_MOUSE Centromere protein U OS=Mus musculus OX=10090 GN=Cenpu PE=1 SV=2
6	AFDB:P38313	0.174	0.152	3.649E-2	324	0.127	0.105	P38313.pdb.gz	CENPU_YEAST Inner kinetochore subunit AME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AME1 PE=1 SV=1
7	AFDB:Q9H410	0.189	0.147	3.649E-2	356	0.146	0.110	Q9H410.pdb.gz	DSN1_HUMAN Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1 PE=1 SV=2
8	AFDB:O94643	0.135	0.091	4.750E-2	441	0.142	0.086	O94643.pdb.gz	CENPU_SCHPO Inner kinetochore subunit mis17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis17 PE=1 SV=2
9	AFDB:Q71F23	0.253	0.171	5.418E-2	418	0.123	0.079	Q71F23.pdb.gz	CENPU_HUMAN Centromere protein U OS=Homo sapiens OX=9606 GN=CENPU PE=1 SV=1
10	AFDB:F4IY86	0.281	0.110	1.774E-1	723	0.108	0.040	F4IY86.pdb.gz	F4IY86_ARATH Agenet domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DUF7 PE=1 SV=1
11	AFDB:E1BSJ7	0.276	0.105	2.308E-1	750	0.146	0.052	E1BSJ7.pdb.gz	E1BSJ7_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=3 SV=2
12	PDB:6tz402	0.140	0.197	8.086E-1	176	0.101	0.153	6tz402.pdb.gz
13	PDB:1ykbD	0.161	0.267	2.172	142	0.056	0.106	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
14	PDB:7z0oG	0.148	0.343	2.172	84	0.045	0.143	7z0oG.pdb.gz	Mechanism of RNA polymerase I selection by transcription factor UAF.
15	PDB:7kyjB	0.086	0.109	3.020	194	0.015	0.021	7kyjB.pdb.gz	Structure of a GNAT superfamily PA3944 acetyltransferase in complex with zinc
16	PDB:6s1kE	0.126	0.270	3.445	102	0.022	0.059	6s1kE.pdb.gz
17	PDB:6tedQ	0.218	0.081	3.445	890	0.071	0.021	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
18	PDB:3piwA	0.140	0.200	3.930	154	0.049	0.084	3piwA.pdb.gz
19	PDB:6wtiD	0.152	0.343	4.198	99	0.011	0.030	6wtiD.pdb.gz	A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
20	PDB:6qlfU	0.176	0.241	4.483	171	0.086	0.135	6qlfU.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L2Z9	0.0	536	268	1.000	1.000	CENPQ_HUMAN Centromere protein Q OS=Homo sapiens OX=9606 GN=CENPQ PE=1 SV=1
2	P02469	0.013	39.3	1786	0.269	0.040	LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3
3	A0A8I5ZQ25	0.026	38.5	1834	0.257	0.038	A0A8I5ZQ25_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
4	A0A8I6A3T2	0.026	38.5	1792	0.257	0.039	A0A8I6A3T2_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
5	D3ZQN7	0.026	38.5	1786	0.257	0.039	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
6	A0A8I5ZVQ5	0.087	36.6	1741	0.205	0.032	A0A8I5ZVQ5_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
7	Q9BXF3	0.12	36.2	1484	0.108	0.020	CECR2_HUMAN Chromatin remodeling regulator CECR2 OS=Homo sapiens OX=9606 GN=CECR2 PE=1 SV=2
8	P11046	0.27	35.0	1788	0.146	0.022	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
9	Q580K2	4.1	31.2	360	0.097	0.072	Q580K2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.710 PE=4 SV=1
10	G5ECE3	4.4	31.6	3102	0.168	0.015	LAM3_CAEEL Laminin subunit alpha lam-3 OS=Caenorhabditis elegans OX=6239 GN=lam-3 PE=1 SV=1
11	E9Q0F0	5.4	31.2	1068	0.097	0.024	E9Q0F0_MOUSE Keratin 78 OS=Mus musculus OX=10090 GN=Krt78 PE=1 SV=1
12	Q585F7	9.2	30.4	1564	0.093	0.016	Q585F7_TRYB2 SAC3/GANP/THP3 conserved domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.240 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13094 CENP-Q	9.5e-21	86.2	CENP-Q, a CENPA-CAD centromere complex subunit
2	PF19111 DUF5798	73	15.0	Family of unknown function (DUF5798)
3	PF12920 TcdA_TcdB_pore	3.7e+02	10.8	TcdA/TcdB pore forming domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337289

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364737	0.999	Centromere protein P
2	9606.ENSP00000281453	0.998	Centromere protein U
3	9606.ENSP00000360133	0.998	Centromere protein R
4	9606.ENSP00000370214	0.998	Centromere protein O
5	9606.ENSP00000283006	0.988	Centromere protein H
6	9606.ENSP00000362018	0.988	Centromere protein I
7	9606.ENSP00000379911	0.987	Centromere protein K
8	9606.ENSP00000215980	0.983	Centromere protein M
9	9606.ENSP00000377007	0.983	Centromere protein N
10	9606.ENSP00000457810	0.983	Centromere protein T
11	9606.ENSP00000308583	0.973	Centromere protein S
12	9606.ENSP00000273853	0.965	Centromere protein C
13	9606.ENSP00000376168	0.956	Centromere protein X
14	9606.ENSP00000348527	0.954	Centromere protein L
15	9606.ENSP00000357308	0.933	Constitutive centromere associated network
16	9606.ENSP00000336868	0.873	Histone H3-like centromeric protein A
17	9606.ENSP00000335463	0.812	Kinetochore scaffold 1
18	9606.ENSP00000309790	0.763	Mis18-binding protein 1
19	9606.ENSP00000290130	0.755	Protein Mis18-alpha
20	9606.ENSP00000220514	0.752	Protein Mis18-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0022402	0.966	cell cycle process
GO:0051641	0.940	cellular localization
GO:0048518	0.937	positive regulation of biological process
GO:0048522	0.928	positive regulation of cellular process
GO:0007059	0.911	chromosome segregation
GO:0098813	0.890	nuclear chromosome segregation
GO:0051656	0.878	establishment of organelle localization
GO:0051303	0.866	establishment of chromosome localization
GO:0051310	0.814	metaphase plate congression
GO:1903829	0.711	positive regulation of protein localization
GO:0071840	0.526	cellular component organization or biogenesis
GO:0016043	0.502	cellular component organization
GO:0006996	0.300	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0015629	0.996	actin cytoskeleton
GO:0005694	0.866	chromosome
GO:0032991	0.746	protein-containing complex
GO:0000775	0.746	chromosome, centromeric region
GO:0000793	0.707	condensed chromosome
GO:0000776	0.444	kinetochore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]