StarFunc result for job id Q7L3T8

User Input

>input (475 residues)
MEGLLTRCRALPALATCSRQLSGYVPCRFHHCAPRRGRRLLLSRVFQPQNLREDRVLSLQ
DKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVIDQEMQAIGGQKVNMP
SLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAITALIASQKKLSYKQLPFL
LYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQQTYSLVCDAYCSLFNKLGLP
FVKVQADVGTIGGTVSHEFQLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPACQGPLT
KTKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAEMGCYGLGVTRILAAAIEVLSTEDC
VRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEAVPQLHGEVLLDDRTHLTIGN
RLKDANKFGYPFVIIAGKRALEDPAHFEVWCQNTGEVAFLTKDGVMDLLTPVQTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CFI5	0.912	0.912	7.235E-88	475	0.819	0.819	Q8CFI5.pdb.gz	SYPM_MOUSE Probable proline--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Pars2 PE=1 SV=2
2	AFDB:Q86P96	0.854	0.885	3.244E-55	458	0.392	0.406	Q86P96.pdb.gz	Q86P96_DROME proline--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ProRS-m PE=2 SV=1
3	AFDB:O74765	0.827	0.922	2.944E-51	425	0.366	0.409	O74765.pdb.gz	SYPM_SCHPO Probable proline--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC24C6.03 PE=3 SV=1
4	AFDB:P16659	0.784	0.656	5.164E-46	572	0.343	0.285	P16659.pdb.gz	SYP_ECOLI Proline--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=proS PE=1 SV=4
5	AFDB:P9WFT9	0.823	0.675	2.145E-45	582	0.328	0.268	P9WFT9.pdb.gz	SYP_MYCTU Proline--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=proS PE=1 SV=1
6	AFDB:P39965	0.775	0.643	1.464E-41	576	0.312	0.257	P39965.pdb.gz	SYPM_YEAST Probable proline--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM10 PE=1 SV=1
7	AFDB:Q8I5R7	0.711	0.461	1.782E-28	746	0.158	0.101	Q8I5R7.pdb.gz	SYP_PLAF7 Proline--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=proRS PE=1 SV=1
8	AFDB:P38708	0.691	0.484	2.810E-28	688	0.171	0.118	P38708.pdb.gz	YHI0_YEAST Putative proline--tRNA ligase YHR020W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR020W PE=1 SV=1
9	AFDB:Q9FYR6	0.680	0.600	1.466E-27	543	0.179	0.157	Q9FYR6.pdb.gz	SYPM_ARATH Proline--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA6 PE=2 SV=1
10	PDB:1nj1A	0.696	0.714	5.853E-27	463	0.162	0.166	1nj1A.pdb.gz	The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
11	AFDB:O26708	0.701	0.691	6.089E-27	482	0.166	0.164	O26708.pdb.gz	SYP_METTH Proline--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=proS PE=1 SV=1
12	PDB:1qf6A	0.637	0.481	1.606E-23	641	0.141	0.105	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
13	PDB:5e6mA	0.601	0.555	1.123E-20	519	0.139	0.127	5e6mA.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
14	PDB:5e6mB	0.597	0.564	1.035E-19	506	0.139	0.130	5e6mB.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
15	PDB:1atiA	0.627	0.677	1.729E-19	437	0.149	0.162	1atiA.pdb.gz	Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
16	PDB:3ugtC	0.606	0.668	4.552E-19	427	0.158	0.176	3ugtC.pdb.gz	Yeast mitochondrial threonyl-tRNA synthetase recognizes tRNA isoacceptors by distinct mechanisms and promotes CUN codon reassignment.
17	PDB:2zt5A	0.645	0.582	1.891E-18	530	0.137	0.123	2zt5A.pdb.gz	Crystal structures and biochemical analyses suggest unique mechanism and role for human GlyRS in Ap4A homeostasis
18	PDB:1httA	0.429	0.526	1.845E-17	366	0.114	0.148	1httA.pdb.gz	Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate.
19	PDB:4kqeA	0.601	0.488	3.453E-17	597	0.143	0.114	4kqeA.pdb.gz
20	PDB:4x5oB	0.433	0.550	4.859E-17	350	0.120	0.163	4x5oB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CFI5	0.0	816	475	0.819	0.819	SYPM_MOUSE Probable proline--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Pars2 PE=1 SV=2
2	Q9VZY9	6.25e-122	365	458	0.389	0.404	Q9VZY9_DROME proline--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ProRS-m PE=1 SV=1
3	Q86P96	3.98e-121	363	458	0.385	0.400	Q86P96_DROME proline--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ProRS-m PE=2 SV=1
4	O74765	1.34e-107	328	425	0.354	0.395	SYPM_SCHPO Probable proline--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC24C6.03 PE=3 SV=1
5	Q6NQW5	1.12e-88	276	335	0.291	0.412	Q6NQW5_DROME AT04665p OS=Drosophila melanogaster OX=7227 GN=ProRS-m PE=2 SV=1
6	P16659	1.43e-63	218	572	0.217	0.180	SYP_ECOLI Proline--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=proS PE=1 SV=4
7	P9WFT9	2.00e-53	191	582	0.196	0.160	SYP_MYCTU Proline--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=proS PE=1 SV=1
8	P39965	6.76e-50	181	576	0.208	0.172	SYPM_YEAST Probable proline--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM10 PE=1 SV=1
9	A0A1D8PCV0	2.02e-17	86.7	455	0.234	0.244	A0A1D8PCV0_CANAL threonine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MST1 PE=4 SV=1
10	M9PBJ9	5.43e-17	79.3	123	0.072	0.276	M9PBJ9_DROME Prolyl-tRNA synthetase, mitochondrial, isoform B OS=Drosophila melanogaster OX=7227 GN=ProRS-m PE=4 SV=1
11	P07236	2.60e-12	70.9	462	0.206	0.212	SYTM_YEAST Threonine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MST1 PE=1 SV=2
12	O26708	3.63e-11	67.4	482	0.152	0.149	SYP_METTH Proline--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=proS PE=1 SV=1
13	O13969	5.66e-10	63.5	474	0.177	0.177	SYTM_SCHPO Probable threonine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC24C9.09 PE=3 SV=2
14	P87144	2.13e-07	55.8	703	0.158	0.107	SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ths1 PE=3 SV=1
15	P38708	2.53e-07	55.5	688	0.162	0.112	YHI0_YEAST Putative proline--tRNA ligase YHR020W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR020W PE=1 SV=1
16	Q5BBD0	4.30e-07	54.7	594	0.164	0.131	Q5BBD0_EMENI proline--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02150 PE=3 SV=1
17	Q54J66	1.27e-05	50.1	710	0.084	0.056	SYTC1_DICDI Probable threonine--tRNA ligase 1, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=thrS1 PE=3 SV=1
18	O04630	1.56e-05	50.1	709	0.152	0.102	SYTM1_ARATH Threonine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=THRRS PE=1 SV=3
19	P04801	1.42e-04	47.0	734	0.164	0.106	SYTC_YEAST Threonine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THS1 PE=1 SV=2
20	Q8MRL7	4.45e-04	45.4	747	0.168	0.107	Q8MRL7_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15777 Anti-TRAP	1.5e+02	13.7	Tryptophan RNA-binding attenuator protein inhibitory protein
2	PF03129 HGTP_anticodon	0.063	24.8	Anticodon binding domain
3	PF00587 tRNA-synt_2b	1.9e-32	124.2	tRNA synthetase class II core domain (G, H, P, S and T)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360327

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355890	0.997	Bifunctional glutamate/proline--tRNA ligase
2	9606.ENSP00000408576	0.979	Probable leucine--tRNA ligase, mitochondrial
3	9606.ENSP00000395196	0.975	Probable glutamate--tRNA ligase, mitochondrial
4	9606.ENSP00000377954	0.971	Leucine--tRNA ligase, cytoplasmic
5	9606.ENSP00000362576	0.966	Tyrosine--tRNA ligase, cytoplasmic
6	9606.ENSP00000355889	0.961	Isoleucine--tRNA ligase, mitochondrial
7	9606.ENSP00000281038	0.939	Probable asparagine--tRNA ligase, mitochondrial
8	9606.ENSP00000307567	0.936	Glutamine--tRNA ligase
9	9606.ENSP00000261772	0.930	Alanine--tRNA ligase, cytoplasmic
10	9606.ENSP00000262027	0.930	Methionine--tRNA ligase, cytoplasmic
11	9606.ENSP00000472847	0.926	Serine--tRNA ligase, mitochondrial
12	9606.ENSP00000235521	0.906	Tryptophan--tRNA ligase, mitochondrial
13	9606.ENSP00000364794	0.904	Isoleucine--tRNA ligase, cytoplasmic
14	9606.ENSP00000234677	0.900	Serine--tRNA ligase, cytoplasmic
15	9606.ENSP00000387710	0.900	Threonine--tRNA ligase, cytoplasmic
16	9606.ENSP00000320658	0.899	Tyrosine--tRNA ligase, mitochondrial
17	9606.ENSP00000358549	0.897	Probable arginine--tRNA ligase, mitochondrial
18	9606.ENSP00000441000	0.897	Valine--tRNA ligase, mitochondrial
19	9606.ENSP00000358060	0.896	Threonine--tRNA ligase, mitochondrial
20	9606.ENSP00000316335	0.886	Phenylalanine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004812	1.000	aminoacyl-tRNA ligase activity
GO:0005515	0.997	protein binding
GO:1901363	0.834	heterocyclic compound binding
GO:0097159	0.824	organic cyclic compound binding
GO:0004827	0.712	proline-tRNA ligase activity
GO:0003676	0.498	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006418	0.995	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.961	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	1.000	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:14305	0.712	ATP + L-proline + tRNA(Pro) = AMP + diphosphate + L-prolyl-tRNA(Pro)
EC:6.1.1.15	0.712	proline--tRNA ligase.

[back to server]