StarFunc result for job id Q7L3V2

User Input

>input (364 residues)
MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRT
TMEQKSTASGTCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQ
LGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQ
DPNSFAEYHAVVTCPLPLASSQLPVAPQLPVVRQYLARFLEGLALDMGTAPRSLPAAMAT
PAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSSKPGPVEPASSQPEEAAPTPV
PRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVEAPETPGEPPL
SPGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L3V2	0.999	0.999	5.516E-51	364	1.000	1.000	Q7L3V2.pdb.gz	BOP_HUMAN Protein Bop OS=Homo sapiens OX=9606 GN=RTL10 PE=1 SV=1
2	AFDB:Q76PD2	0.104	0.062	1.810E-2	732	0.154	0.077	Q76PD2.pdb.gz	HEL2_SCHPO E3 ubiquitin-protein ligase hel2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1223.01 PE=1 SV=2
3	AFDB:C8JQS1	0.091	0.064	1.073E-1	561	0.151	0.098	C8JQS1.pdb.gz	C8JQS1_CAEEL Uncharacterized protein OS=Caenorhabditis elegans OX=6239 GN=osm-7 PE=1 SV=1
4	AFDB:Q09801	0.105	0.110	2.162E-1	344	0.159	0.169	Q09801.pdb.gz	FIP1X_SCHPO Pre-mRNA polyadenylation factor fip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22G7.10 PE=3 SV=1
5	AFDB:Q7ZV84	0.087	0.064	4.854E-1	555	0.113	0.074	Q7ZV84.pdb.gz	DAAF1_DANRE Dynein axonemal assembly factor 1 OS=Danio rerio OX=7955 GN=dnaaf1 PE=2 SV=2
6	AFDB:A0A1D5NS60	0.099	0.072	6.356E-1	528	0.121	0.083	A0A1D5NS60.pdb.gz	ZN16L_DANRE Zinc finger protein 16-like OS=Danio rerio OX=7955 GN=znf16l PE=1 SV=1
7	AFDB:A0A1W2PS91	0.105	0.097	6.356E-1	400	0.143	0.130	A0A1W2PS91.pdb.gz	A0A1W2PS91_HUMAN Paired box 6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
8	AFDB:O76903	0.087	0.041	6.708E-1	1012	0.115	0.042	O76903.pdb.gz	O76903_DROME EG:80H7.7 protein OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
9	AFDB:Q6ZQL4	0.102	0.071	7.079E-1	677	0.093	0.050	Q6ZQL4.pdb.gz	WDR43_MOUSE WD repeat-containing protein 43 OS=Mus musculus OX=10090 GN=Wdr43 PE=1 SV=2
10	AFDB:Q93XW7	0.083	0.071	7.079E-1	437	0.135	0.112	Q93XW7.pdb.gz	C3H40_ARATH Zinc finger CCCH domain-containing protein 40 OS=Arabidopsis thaliana OX=3702 GN=At3g21810 PE=1 SV=1
11	PDB:5xtcw	0.070	0.076	2.393	320	0.055	0.062	5xtcw.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
12	PDB:6ytvA	0.078	0.099	2.393	252	0.074	0.107	6ytvA.pdb.gz
13	PDB:6gmlU	0.096	0.160	3.490	183	0.071	0.142	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
14	PDB:7x3kA	0.086	0.111	3.490	262	0.066	0.092	7x3kA.pdb.gz
15	PDB:4h67C	0.080	0.085	5.670	338	0.055	0.059	4h67C.pdb.gz	The Last Piece in the Vitamin B1 Biosynthesis Puzzle: STRUCTURAL AND FUNCTIONAL INSIGHT INTO YEAST 4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE PHOSPHATE (HMP-P) SYNTHASE.
16	PDB:7wffG	0.100	0.178	5.670	167	0.041	0.090	7wffG.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
17	PDB:6qvk1e	0.080	0.086	6.666	280	0.036	0.046	6qvk1e.pdb.gz
18	PDB:6j6gc	0.080	0.070	7.836	436	0.044	0.037	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
19	PDB:2mxxA	0.065	0.096	8.728	179	0.085	0.173	2mxxA.pdb.gz
20	PDB:2n5gA	0.065	0.167	8.728	101	0.052	0.188	2n5gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L3V2	0.0	738	364	1.000	1.000	BOP_HUMAN Protein Bop OS=Homo sapiens OX=9606 GN=RTL10 PE=1 SV=1
2	A6ZKI3	5.17e-07	50.1	113	0.074	0.239	RTL8C_HUMAN Retrotransposon Gag-like protein 8C OS=Homo sapiens OX=9606 GN=RTL8C PE=1 SV=1
3	O95751	6.63e-07	50.4	146	0.063	0.158	LDOC1_HUMAN Protein LDOC1 OS=Homo sapiens OX=9606 GN=LDOC1 PE=1 SV=1
4	A0A087WZG9	1.71e-06	51.6	359	0.074	0.075	A0A087WZG9_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
5	Q17RB0	1.88e-06	48.5	113	0.071	0.230	RTL8B_HUMAN Retrotransposon Gag-like protein 8B OS=Homo sapiens OX=9606 GN=RTL8B PE=1 SV=1
6	A0A087WX23	2.93e-06	51.6	783	0.074	0.034	A0A087WX23_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
7	Q9BWD3	3.21e-06	47.8	113	0.071	0.230	RTL8A_HUMAN Retrotransposon Gag-like protein 8A OS=Homo sapiens OX=9606 GN=RTL8A PE=1 SV=3
8	A0A087WUL4	3.85e-06	51.2	741	0.077	0.038	A0A087WUL4_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
9	Q86TG7	4.86e-06	50.8	708	0.077	0.040	PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
10	A0A087WXK2	4.94e-06	50.8	707	0.077	0.040	A0A087WXK2_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
11	Q7TPY9	4.45e-05	45.4	151	0.058	0.139	LDOC1_MOUSE Protein LDOC1 OS=Mus musculus OX=10090 GN=Ldoc1 PE=2 SV=1
12	Q7TN75	8.42e-05	47.0	958	0.074	0.028	PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus OX=10090 GN=Peg10 PE=1 SV=2
13	Q9I7U4	0.016	40.0	18141	0.085	0.002	TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 GN=sls PE=1 SV=3
14	C9E3B4	0.037	38.5	1566	0.058	0.013	C9E3B4_STRMG Surface protein adhesin OS=Streptococcus mutans OX=1309 GN=spaP PE=1 SV=1
15	Q8I519	0.25	36.2	2359	0.069	0.011	Q8I519_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1240600 PE=4 SV=1
16	Q23542	1.2	33.9	1326	0.066	0.018	Q23542_CAEEL Dynactin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dnc-1 PE=1 SV=2
17	E2JKZ0	1.3	33.9	1351	0.066	0.018	E2JKZ0_CAEEL Dynactin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dnc-1 PE=1 SV=1
18	Q8CJH3	7.7	31.2	2119	0.049	0.008	PLXB1_MOUSE Plexin-B1 OS=Mus musculus OX=10090 GN=Plxnb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16297 DUF4939	7.2e-07	40.4	Domain of unknown function (DUF4939)
2	PF19259 Ty3_capsid	21	16.0	Ty3 transposon capsid-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358022	0.991	Induced myeloid leukemia cell differentiation protein Mcl-1
2	9606.ENSP00000302564	0.990	Bcl-2-like protein 1
3	9606.ENSP00000376943	0.880	Bcl-2-like protein 11
4	9606.ENSP00000326119	0.873	Phorbol-12-myristate-13-acetate-induced protein 1
5	9606.ENSP00000355231	0.829	Beclin-1
6	9606.ENSP00000250405	0.786	Bcl-2-like protein 2
7	9606.ENSP00000307786	0.747	Cytochrome c
8	9606.ENSP00000452479	0.747	BCL2L2-PABPN1 readthrough
9	9606.ENSP00000346697	0.737	Bcl-2-modifying factor
10	9606.ENSP00000330237	0.730	Caspase-9
11	9606.ENSP00000351273	0.718	Caspase-8
12	9606.ENSP00000448165	0.715	Apoptotic protease-activating factor 1
13	9606.ENSP00000267953	0.699	Bcl-2-related protein A1
14	9606.ENSP00000257572	0.688	Activator of apoptosis harakiri
15	9606.ENSP00000216115	0.684	Bcl-2-interacting killer
16	9606.ENSP00000311032	0.681	Caspase-3
17	9606.ENSP00000357625	0.681	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
18	9606.ENSP00000404503	0.681	Bcl-2-binding component 3
19	9606.ENSP00000223366	0.660	Glucokinase
20	9606.ENSP00000265333	0.651	Voltage-dependent anion-selective channel protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0097190	0.992	apoptotic signaling pathway
GO:0007005	0.977	mitochondrion organization
GO:0051641	0.975	cellular localization
GO:0051234	0.965	establishment of localization
GO:0090559	0.958	regulation of membrane permeability
GO:0006839	0.958	mitochondrial transport
GO:0007006	0.957	mitochondrial membrane organization
GO:0008637	0.956	apoptotic mitochondrial changes
GO:0042391	0.945	regulation of membrane potential
GO:0051881	0.944	regulation of mitochondrial membrane potential
GO:0046902	0.897	regulation of mitochondrial membrane permeability
GO:0048518	0.665	positive regulation of biological process
GO:0019222	0.662	regulation of metabolic process
GO:0048522	0.649	positive regulation of cellular process
GO:0060255	0.448	regulation of macromolecule metabolic process
GO:0009893	0.419	positive regulation of metabolic process
GO:0080090	0.396	regulation of primary metabolic process
GO:0031323	0.391	regulation of cellular metabolic process
GO:0051171	0.388	regulation of nitrogen compound metabolic process
GO:0008152	0.360	metabolic process
GO:0051173	0.336	positive regulation of nitrogen compound metabolic process
GO:0010941	0.326	regulation of cell death
GO:0071704	0.325	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0005634	0.930	nucleus
GO:0016020	0.503	membrane
GO:0005829	0.447	cytosol
GO:0032991	0.424	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]