StarFunc result for job id Q7L576

User Input

>input (1253 residues)
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLAD
IVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT
DKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTV
YAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL
ELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVC
DLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7usdA	0.912	0.963	0.000	1185	0.944	0.998	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
2	AFDB:A0A2R8PX02	0.978	0.977	0.000	1254	0.871	0.870	A0A2R8PX02.pdb.gz
3	AFDB:D4A8H8	0.975	0.975	0.000	1253	0.992	0.992	D4A8H8.pdb.gz	D4A8H8_RAT Cytoplasmic FMR1-interacting protein OS=Rattus norvegicus OX=10116 GN=Cyfip1 PE=3 SV=1
4	AFDB:Q96F07	0.955	0.936	0.000	1278	0.871	0.854	Q96F07.pdb.gz	CYFP2_HUMAN Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2 PE=1 SV=2
5	AFDB:Q9VF87	0.974	0.946	0.000	1291	0.669	0.649	Q9VF87.pdb.gz	CYFIP_DROME Cytoplasmic FMR1-interacting protein OS=Drosophila melanogaster OX=7227 GN=Cyfip PE=1 SV=1
6	AFDB:O44518	0.946	0.939	1.314E-102	1262	0.517	0.513	O44518.pdb.gz	CYFIP_CAEEL Cytoplasmic FMR1-interacting protein homolog OS=Caenorhabditis elegans OX=6239 GN=gex-2 PE=1 SV=4
7	AFDB:Q6UK63	0.891	0.837	8.226E-77	1336	0.373	0.350	Q6UK63.pdb.gz	PIRA_DICDI Protein pirA OS=Dictyostelium discoideum OX=44689 GN=pirA PE=1 SV=1
8	AFDB:Q5S2C3	0.867	0.848	4.255E-61	1282	0.283	0.277	Q5S2C3.pdb.gz	PIR_ARATH Protein PIR OS=Arabidopsis thaliana OX=3702 GN=PIR PE=1 SV=2
9	AFDB:Q54R74	0.483	0.520	3.218E-15	1135	0.118	0.130	Q54R74.pdb.gz	WASC4_DICDI WASH complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=washc4 PE=1 SV=1
10	AFDB:P55162	0.429	0.466	6.119E-14	1126	0.128	0.143	P55162.pdb.gz	HEM_DROME Membrane-associated protein Hem OS=Drosophila melanogaster OX=7227 GN=Hem PE=2 SV=1
11	PDB:7useB	0.439	0.489	1.425E-13	1099	0.120	0.136	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
12	AFDB:Q8K1X4	0.423	0.457	1.532E-13	1134	0.116	0.128	Q8K1X4.pdb.gz	NCKPL_MOUSE Nck-associated protein 1-like OS=Mus musculus OX=10090 GN=Nckap1l PE=1 SV=1
13	PDB:7vf2A	0.085	0.088	2.103E-4	1196	0.115	0.120	7vf2A.pdb.gz
14	PDB:7qdrB	0.070	0.070	9.347E-4	1212	0.125	0.130	7qdrB.pdb.gz
15	PDB:7unkA	0.073	0.083	9.347E-4	1047	0.113	0.136	7unkA.pdb.gz
16	PDB:7z8fe	0.066	0.028	9.711E-4	4579	0.129	0.035	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
17	PDB:7pgsN	0.104	0.086	1.009E-3	1787	0.127	0.089	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
18	PDB:7pgrN	0.066	0.047	1.370E-3	2423	0.125	0.064	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
19	PDB:6reyc	0.080	0.065	1.791E-3	1773	0.133	0.094	6reyc.pdb.gz	Characterization of Fully Recombinant Human 20S and 20S-PA200 Proteasome Complexes.
20	PDB:7mp6B	0.077	0.067	1.861E-3	1609	0.119	0.093	7mp6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K472	0.0	2524	1251	0.968	0.970	A0A0G2K472_RAT Cytoplasmic FMR1-interacting protein OS=Rattus norvegicus OX=10116 GN=Cyfip1 PE=1 SV=1
2	A5A5E1	0.0	2311	1253	0.872	0.872	A5A5E1_DANRE Cytoplasmic FMR1-interacting protein OS=Danio rerio OX=7955 GN=zgc:194528 PE=1 SV=1
3	B3DIT1	0.0	2317	1252	0.872	0.872	B3DIT1_DANRE Cytoplasmic FMR1-interacting protein OS=Danio rerio OX=7955 GN=zgc:194528 PE=1 SV=1
4	D4A8H8	0.0	2603	1253	0.992	0.992	D4A8H8_RAT Cytoplasmic FMR1-interacting protein OS=Rattus norvegicus OX=10116 GN=Cyfip1 PE=3 SV=1
5	O44518	0.0	1335	1262	0.519	0.515	CYFIP_CAEEL Cytoplasmic FMR1-interacting protein homolog OS=Caenorhabditis elegans OX=6239 GN=gex-2 PE=1 SV=4
6	Q5SQX6	0.0	2325	1253	0.875	0.875	CYFP2_MOUSE Cytoplasmic FMR1-interacting protein 2 OS=Mus musculus OX=10090 GN=Cyfip2 PE=1 SV=2
7	Q6UK63	0.0	802	1336	0.379	0.356	PIRA_DICDI Protein pirA OS=Dictyostelium discoideum OX=44689 GN=pirA PE=1 SV=1
8	Q7L576	0.0	2616	1253	1.000	1.000	CYFP1_HUMAN Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1 PE=1 SV=1
9	Q7TMB8	0.0	2602	1253	0.990	0.990	CYFP1_MOUSE Cytoplasmic FMR1-interacting protein 1 OS=Mus musculus OX=10090 GN=Cyfip1 PE=1 SV=1
10	Q96F07	0.0	2311	1278	0.876	0.859	CYFP2_HUMAN Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2 PE=1 SV=2
11	Q9VF87	0.0	1773	1291	0.674	0.654	CYFIP_DROME Cytoplasmic FMR1-interacting protein OS=Drosophila melanogaster OX=7227 GN=Cyfip PE=1 SV=1
12	Q5S2C3	2.61e-156	504	1282	0.299	0.293	PIR_ARATH Protein PIR OS=Arabidopsis thaliana OX=3702 GN=PIR PE=1 SV=2
13	Q09387	0.009	42.4	334	0.032	0.120	Q09387_CAEEL CYRIA/CYRIB Rac1 binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_R07G3.8 PE=1 SV=1
14	P85091	0.36	33.5	51	0.016	0.392	CYFP1_BOVIN Cytoplasmic FMR1-interacting protein 1 (Fragments) OS=Bos taurus OX=9913 GN=CYFIP1 PE=1 SV=1
15	Q04431	2.0	34.7	385	0.045	0.148	KRE28_YEAST Spindle pole body component KRE28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE28 PE=1 SV=1
16	P47820	4.0	34.3	1313	0.018	0.018	ACE_RAT Angiotensin-converting enzyme OS=Rattus norvegicus OX=10116 GN=Ace PE=1 SV=1
17	Q1D2Y0	4.7	33.9	884	0.018	0.025	Q1D2Y0_MYXXD ATP-dependent Clp protease, ATP-binding subunit ClpC OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=clpC PE=3 SV=1
18	Q24170	8.0	33.1	966	0.011	0.014	Q24170_DROME KSR OS=Drosophila melanogaster OX=7227 GN=ksr PE=2 SV=1
19	Q8ISD9	8.0	33.1	966	0.011	0.014	Q8ISD9_DROME Kinase suppressor of ras OS=Drosophila melanogaster OX=7227 GN=ksr PE=4 SV=1
20	Q8I0R4	8.1	33.1	966	0.011	0.014	Q8I0R4_DROME Kinase suppressor of ras OS=Drosophila melanogaster OX=7227 GN=ksr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07159 CYRIA-B_Rac1-bd	0.00032	31.6	CYRIA/CYRIB Rac1 binding domain
2	PF05994 FragX_IP	0	1315.5	Cytoplasmic Fragile-X interacting family
3	PF03722 Hemocyanin_N	3.1e+02	13.4	Hemocyanin, all-alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481038

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295851	0.999	Abl interactor 2
2	9606.ENSP00000354251	0.999	Nck-associated protein 1
3	9606.ENSP00000359506	0.999	Synaptic functional regulator FMR1
4	9606.ENSP00000376368	0.999	Wiskott-Aldrich syndrome protein family member 1
5	9606.ENSP00000432472	0.999	Protein BRICK1
6	9606.ENSP00000425561	0.998	Eukaryotic translation initiation factor 4E
7	9606.ENSP00000365312	0.997	Abl interactor 1
8	9606.ENSP00000483313	0.997	Wiskott-Aldrich syndrome protein family member 2
9	9606.ENSP00000293373	0.996	Nck-associated protein 1-like
10	9606.ENSP00000335055	0.996	Wiskott-Aldrich syndrome protein family member 3
11	9606.ENSP00000337618	0.992	Magnesium transporter NIPA2
12	9606.ENSP00000480316	0.992	Gamma-tubulin complex component 5
13	9606.ENSP00000250113	0.980	Fragile X mental retardation syndrome-related protein 2
14	9606.ENSP00000350170	0.978	Fragile X mental retardation syndrome-related protein 1
15	9606.ENSP00000337452	0.977	Magnesium transporter NIPA1
16	9606.ENSP00000361423	0.939	Tyrosine-protein kinase ABL1
17	9606.ENSP00000348461	0.937	Ras-related C3 botulinum toxin substrate 1
18	9606.ENSP00000356395	0.937	Complement factor H-related protein 3
19	9606.ENSP00000316338	0.922	Brain-specific angiogenesis inhibitor 1-associated protein 2
20	9606.ENSP00000263025	0.913	Mitogen-activated protein kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.768	enzyme binding
GO:1901363	0.653	heterocyclic compound binding
GO:0097159	0.653	organic cyclic compound binding
GO:0003676	0.549	nucleic acid binding
GO:0003723	0.454	RNA binding
GO:0031267	0.401	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0016043	0.962	cellular component organization
GO:0050794	0.958	regulation of cellular process
GO:0050896	0.950	response to stimulus
GO:0048518	0.942	positive regulation of biological process
GO:0048856	0.937	anatomical structure development
GO:0051128	0.906	regulation of cellular component organization
GO:0048522	0.901	positive regulation of cellular process
GO:0032501	0.900	multicellular organismal process
GO:0009653	0.900	anatomical structure morphogenesis
GO:0030030	0.881	cell projection organization
GO:0007399	0.863	nervous system development
GO:0120036	0.849	plasma membrane bounded cell projection organization
GO:0048858	0.848	cell projection morphogenesis
GO:0042221	0.842	response to chemical
GO:0120039	0.822	plasma membrane bounded cell projection morphogenesis
GO:0120032	0.816	regulation of plasma membrane bounded cell projection assembly
GO:0048812	0.809	neuron projection morphogenesis
GO:0060041	0.795	retina development in camera-type eye
GO:0044089	0.794	positive regulation of cellular component biogenesis
GO:0051716	0.777	cellular response to stimulus
GO:0120034	0.756	positive regulation of plasma membrane bounded cell projection assembly
GO:0061564	0.746	axon development
GO:0048588	0.712	developmental cell growth
GO:0000904	0.671	cell morphogenesis involved in differentiation
GO:0003008	0.605	system process
GO:0001964	0.586	startle response
GO:0031290	0.585	retinal ganglion cell axon guidance
GO:0019222	0.562	regulation of metabolic process
GO:0065008	0.553	regulation of biological quality
GO:0060560	0.527	developmental growth involved in morphogenesis
GO:0050793	0.514	regulation of developmental process
GO:0048519	0.489	negative regulation of biological process
GO:0080090	0.443	regulation of primary metabolic process
GO:0060255	0.443	regulation of macromolecule metabolic process
GO:0051171	0.440	regulation of nitrogen compound metabolic process
GO:0031323	0.439	regulation of cellular metabolic process
GO:0048646	0.436	anatomical structure formation involved in morphogenesis
GO:0007154	0.434	cell communication
GO:0023052	0.429	signaling
GO:0007165	0.420	signal transduction
GO:0071704	0.375	organic substance metabolic process
GO:0044238	0.357	primary metabolic process
GO:0048592	0.336	eye morphogenesis
GO:0006996	0.328	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.999	cell junction
GO:0005737	0.999	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0043229	0.995	intracellular organelle
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0070013	0.988	intracellular organelle lumen
GO:0012505	0.969	endomembrane system
GO:0005829	0.952	cytosol
GO:0005576	0.939	extracellular region
GO:0031209	0.897	SCAR complex
GO:0031982	0.887	vesicle
GO:0045202	0.881	synapse
GO:0016020	0.836	membrane
GO:0070062	0.816	extracellular exosome
GO:0005634	0.747	nucleus
GO:0031981	0.699	nuclear lumen
GO:0005654	0.670	nucleoplasm
GO:0120025	0.619	plasma membrane bounded cell projection
GO:0071944	0.459	cell periphery
GO:0005886	0.448	plasma membrane
GO:0043005	0.434	neuron projection
GO:0043232	0.431	intracellular non-membrane-bounded organelle
GO:0098794	0.395	postsynapse
GO:0005856	0.356	cytoskeleton
GO:0036477	0.353	somatodendritic compartment
GO:0001726	0.348	ruffle
GO:0030425	0.309	dendrite
GO:0030424	0.308	axon
GO:0044297	0.307	cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]