StarFunc result for job id Q7L5D6

User Input

>input (327 residues)
MAAAAAMAEQESARNGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHT
EARELMYSGALLFFSHGQQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSP
ERVTFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCANMLV
EYSTSRGFRSEVDMFVAQAVLQFLCLKNKSSASVVFTTYTQKHPSIEDGPPFVEPLLNFI
WFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGN
LLTSLMGSSEQEDGEESPSDGSPIELD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LXF5	0.891	0.883	1.247E-37	330	0.948	0.939	F1LXF5.pdb.gz	F1LXF5_RAT Guided entry of tail-anchored proteins factor 4 OS=Rattus norvegicus OX=10116 GN=Get4 PE=1 SV=2
2	PDB:7ru9C	0.786	0.944	3.117E-30	271	0.826	0.996	7ru9C.pdb.gz	Structural insights into metazoan pretargeting GET complexes.
3	AFDB:Q12125	0.753	0.786	1.142E-11	312	0.245	0.256	Q12125.pdb.gz	GET4_YEAST Golgi to ER traffic protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GET4 PE=1 SV=1
4	AFDB:Q6GKV1	0.662	0.668	1.142E-11	324	0.281	0.284	Q6GKV1.pdb.gz	GET4_ARATH Protein GET4 OS=Arabidopsis thaliana OX=3702 GN=MDC12.19 PE=1 SV=1
5	AFDB:Q19824	0.690	0.630	4.023E-11	362	0.263	0.238	Q19824.pdb.gz	Q19824_CAEEL Conserved Edge Expressed protein OS=Caenorhabditis elegans OX=6239 GN=cee-1 PE=1 SV=1
6	AFDB:O74432	0.714	0.766	7.240E-11	303	0.263	0.284	O74432.pdb.gz	GET4_SCHPO Golgi to ER traffic protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=get4 PE=3 SV=1
7	PDB:3lkuE	0.722	0.805	9.228E-11	291	0.232	0.261	3lkuE.pdb.gz	Structural characterization of the Get4/Get5 complex and its interaction with Get3.
8	AFDB:P32602	0.314	0.338	3.387E-5	292	0.116	0.130	P32602.pdb.gz	SEC17_YEAST Alpha-soluble NSF attachment protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC17 PE=1 SV=4
9	AFDB:Q23983	0.294	0.323	6.629E-5	292	0.144	0.161	Q23983.pdb.gz	SNAP_DROME Alpha-soluble NSF attachment protein OS=Drosophila melanogaster OX=7227 GN=alphaSnap PE=1 SV=1
10	AFDB:A1L245	0.326	0.348	7.841E-5	295	0.110	0.122	A1L245.pdb.gz	A1L245_DANRE Zgc:158643 OS=Danio rerio OX=7955 GN=zgc:158643 PE=2 SV=1
11	AFDB:Q9SPE6	0.303	0.337	1.193E-4	289	0.125	0.142	Q9SPE6.pdb.gz	SNAA2_ARATH Alpha-soluble NSF attachment protein 2 OS=Arabidopsis thaliana OX=3702 GN=ASNAP2 PE=1 SV=1
12	AFDB:Q54NP6	0.310	0.332	1.472E-4	291	0.104	0.117	Q54NP6.pdb.gz	SNAA_DICDI Alpha-soluble NSF attachment protein OS=Dictyostelium discoideum OX=44689 GN=snpA PE=1 SV=1
13	PDB:1qqeA	0.318	0.349	2.755E-3	281	0.119	0.139	1qqeA.pdb.gz
14	PDB:3txmA	0.264	0.249	1.302E-2	353	0.119	0.110	3txmA.pdb.gz
15	PDB:5dseA	0.178	0.127	2.772E-2	537	0.128	0.078	5dseA.pdb.gz
16	PDB:5mpbQ	0.289	0.232	3.015E-2	434	0.138	0.104	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:7qdrB	0.233	0.081	3.279E-2	1212	0.125	0.034	7qdrB.pdb.gz
18	PDB:3msvA	0.258	0.244	3.719E-2	352	0.113	0.105	3msvA.pdb.gz
19	PDB:6ip1E	0.299	0.317	3.719E-2	292	0.092	0.103	6ip1E.pdb.gz
20	PDB:6xt9D	0.191	0.167	3.878E-2	396	0.125	0.104	6xt9D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LXF5	0.0	581	330	0.927	0.918	F1LXF5_RAT Guided entry of tail-anchored proteins factor 4 OS=Rattus norvegicus OX=10116 GN=Get4 PE=1 SV=2
2	Q7L5D6	0.0	677	327	1.000	1.000	GET4_HUMAN Golgi to ER traffic protein 4 homolog OS=Homo sapiens OX=9606 GN=GET4 PE=1 SV=1
3	Q6GKV1	1.49e-36	135	324	0.291	0.293	GET4_ARATH Protein GET4 OS=Arabidopsis thaliana OX=3702 GN=MDC12.19 PE=1 SV=1
4	O74432	9.85e-24	100	303	0.281	0.304	GET4_SCHPO Golgi to ER traffic protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=get4 PE=3 SV=1
5	Q12125	4.34e-20	90.9	312	0.284	0.298	GET4_YEAST Golgi to ER traffic protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GET4 PE=1 SV=1
6	Q19824	3.47e-19	89.4	362	0.242	0.218	Q19824_CAEEL Conserved Edge Expressed protein OS=Caenorhabditis elegans OX=6239 GN=cee-1 PE=1 SV=1
7	P15261	2.6	32.3	477	0.080	0.055	INGR1_MOUSE Interferon gamma receptor 1 OS=Mus musculus OX=10090 GN=Ifngr1 PE=1 SV=3
8	P9WMQ3	2.6	32.3	1094	0.040	0.012	RECB_MYCTU RecBCD enzyme subunit RecB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=recB PE=1 SV=1
9	Q57UA6	4.8	31.6	948	0.086	0.030	Q57UA6_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.340 PE=3 SV=1
10	Q96BR5	9.4	30.0	231	0.064	0.091	COA7_HUMAN Cytochrome c oxidase assembly factor 7 OS=Homo sapiens OX=9606 GN=COA7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04190 GET4	3.7e-71	251.5	Golgi to ER traffic protein 4
2	PF10366 Vps39_1	1.7e+02	13.9	Vacuolar sorting protein 39 domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358674	0.999	Ubiquitin-like protein 4A
2	9606.ENSP00000365131	0.999	Large proline-rich protein BAG6
3	9606.ENSP00000466379	0.999	ATPase ASNA1
4	9606.ENSP00000221566	0.995	Small glutamine-rich tetratricopeptide repeat-containing protein alpha
5	9606.ENSP00000327716	0.985	Tail-anchored protein insertion receptor WRB
6	9606.ENSP00000370395	0.968	Small glutamine-rich tetratricopeptide repeat-containing protein beta
7	9606.ENSP00000297156	0.957	Calcium signal-modulating cyclophilin ligand
8	9606.ENSP00000292363	0.896	E3 ubiquitin-protein ligase RNF126
9	9606.ENSP00000223641	0.848	Protein transport protein Sec61 subunit beta
10	9606.ENSP00000294179	0.821	Syntaxin-5
11	9606.ENSP00000350708	0.813	UV excision repair protein RAD23 homolog B
12	9606.ENSP00000467024	0.812	UV excision repair protein RAD23 homolog A
13	9606.ENSP00000290649	0.777	E3 ubiquitin-protein ligase AMFR
14	9606.ENSP00000338533	0.759	Tetratricopeptide repeat domain containing
15	9606.ENSP00000341625	0.737	Cytochrome b5
16	9606.ENSP00000312277	0.721	Zinc finger protein 507
17	9606.ENSP00000294413	0.720	Blood group Rh(CE) polypeptide
18	9606.ENSP00000395538	0.717	Trinucleotide repeat-containing gene 18 protein
19	9606.ENSP00000420076	0.717	Stress-associated endoplasmic reticulum protein 1
20	9606.ENSP00000316628	0.695	E3 ubiquitin-protein ligase RNF152

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051087	0.905	chaperone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0061024	0.991	membrane organization
GO:0007029	0.989	endoplasmic reticulum organization
GO:0006605	0.988	protein targeting
GO:0070972	0.987	protein localization to endoplasmic reticulum
GO:0072594	0.987	establishment of protein localization to organelle
GO:0071704	0.982	organic substance metabolic process
GO:0090150	0.979	establishment of protein localization to membrane
GO:0065007	0.974	biological regulation
GO:0044238	0.974	primary metabolic process
GO:0045048	0.973	protein insertion into ER membrane
GO:0006807	0.967	nitrogen compound metabolic process
GO:0050896	0.961	response to stimulus
GO:0006612	0.961	protein targeting to membrane
GO:0019538	0.959	protein metabolic process
GO:0045047	0.959	protein targeting to ER
GO:0044237	0.956	cellular metabolic process
GO:0006950	0.951	response to stress
GO:0051603	0.949	proteolysis involved in protein catabolic process
GO:0051716	0.947	cellular response to stimulus
GO:0033554	0.919	cellular response to stress
GO:0044248	0.895	cellular catabolic process
GO:0042221	0.878	response to chemical
GO:0010498	0.875	proteasomal protein catabolic process
GO:0010033	0.854	response to organic substance
GO:0019941	0.849	modification-dependent protein catabolic process
GO:0034976	0.846	response to endoplasmic reticulum stress
GO:0006511	0.844	ubiquitin-dependent protein catabolic process
GO:0010243	0.838	response to organonitrogen compound
GO:0036503	0.830	ERAD pathway
GO:0065008	0.673	regulation of biological quality
GO:0031647	0.549	regulation of protein stability
GO:0050789	0.408	regulation of biological process
GO:0071816	0.359	tail-anchored membrane protein insertion into ER membrane
GO:0050794	0.345	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0016020	0.976	membrane
GO:0005694	0.975	chromosome
GO:0012505	0.974	endomembrane system
GO:0005730	0.973	nucleolus
GO:0031090	0.887	organelle membrane
GO:0031982	0.683	vesicle
GO:0031410	0.342	cytoplasmic vesicle
GO:0005576	0.323	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]