StarFunc result for job id Q7L5L3

User Input

>input (318 residues)
MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAME
NSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFS
PGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASE
KSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFP
FSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDY
PTALRHYLDNHGPAARTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L5L3	1.000	1.000	2.014E-68	318	1.000	1.000	Q7L5L3.pdb.gz	GDPD3_HUMAN Lysophospholipase D GDPD3 OS=Homo sapiens OX=9606 GN=GDPD3 PE=1 SV=3
2	AFDB:Q99LY2	0.955	0.920	1.833E-56	330	0.770	0.742	Q99LY2.pdb.gz	GDPD3_MOUSE Lysophospholipase D GDPD3 OS=Mus musculus OX=10090 GN=Gdpd3 PE=1 SV=2
3	AFDB:Q6P2T3	0.957	0.966	3.784E-42	315	0.465	0.470	Q6P2T3.pdb.gz	Q6P2T3_DANRE Glycerophosphodiester phosphodiesterase domain containing 1 like OS=Danio rerio OX=7955 GN=gdpd3 PE=2 SV=1
4	AFDB:Q8N9F7	0.950	0.962	5.530E-41	314	0.409	0.414	Q8N9F7.pdb.gz	GDPD1_HUMAN Lysophospholipase D GDPD1 OS=Homo sapiens OX=9606 GN=GDPD1 PE=1 SV=2
5	AFDB:Q9NZC3	0.595	0.574	2.597E-13	331	0.170	0.163	Q9NZC3.pdb.gz	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
6	AFDB:Q08959	0.609	0.604	5.310E-13	321	0.176	0.174	Q08959.pdb.gz	PGC1_YEAST Phosphatidylglycerol phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGC1 PE=1 SV=1
7	AFDB:Q9JL55	0.566	0.546	5.310E-13	331	0.179	0.172	Q9JL55.pdb.gz	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
8	AFDB:P10908	0.555	0.698	1.086E-12	247	0.164	0.211	P10908.pdb.gz	UGPQ_ECOLI Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1
9	AFDB:P09394	0.614	0.552	4.818E-12	358	0.154	0.137	P09394.pdb.gz	GLPQ_ECOLI Glycerophosphodiester phosphodiesterase, periplasmic OS=Escherichia coli (strain K12) OX=83333 GN=glpQ PE=1 SV=2
10	AFDB:A0A2R8QBH7	0.567	0.305	5.428E-12	621	0.154	0.079	A0A2R8QBH7.pdb.gz
11	PDB:1gthA	0.252	0.101	2.788E-4	1019	0.082	0.026	1gthA.pdb.gz	Crystal structure of the productive ternary complex of dihydropyrimidine dehydrogenase with NADPH and 5-iodouracil. Implications for mechanism of inhibition and electron transfer.
12	PDB:4ef8B	0.413	0.417	4.231E-4	314	0.113	0.115	4ef8B.pdb.gz	Target sites for the design of anti-trypanosomatid drugs based on the structure of dihydroorotate dehydrogenase.
13	PDB:3cuzA	0.344	0.232	7.234E-4	529	0.094	0.057	3cuzA.pdb.gz	Atomic resolution structures of Escherichia coli and Bacillus anthracis malate synthase A: comparison with isoform G and implications for structure-based drug discovery
14	PDB:5c54A	0.280	0.285	7.679E-4	310	0.085	0.087	5c54A.pdb.gz
15	PDB:1wq5B	0.408	0.481	1.034E-3	261	0.116	0.142	1wq5B.pdb.gz
16	PDB:5xfwD	0.412	0.415	1.237E-3	315	0.119	0.121	5xfwD.pdb.gz
17	PDB:1f76A	0.417	0.400	1.570E-3	336	0.113	0.107	1f76A.pdb.gz	E. coli Dihydroorotate Dehydrogenase Reveals Structural and Functional Distinction between different classes of dihydroorotate dehydrogenases
18	PDB:3wh9A	0.366	0.343	1.877E-3	345	0.110	0.101	3wh9A.pdb.gz
19	PDB:5taoA	0.397	0.364	1.877E-3	356	0.085	0.076	5taoA.pdb.gz	Crystal structures of a halophilic archaeal malate synthase from Haloferax volcanii and comparisons with isoforms A and G.
20	PDB:3oyzA	0.432	0.379	2.529E-3	376	0.101	0.085	3oyzA.pdb.gz	Crystal structures of a halophilic archaeal malate synthase from Haloferax volcanii and comparisons with isoforms A and G.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L5L3	0.0	658	318	1.000	1.000	GDPD3_HUMAN Lysophospholipase D GDPD3 OS=Homo sapiens OX=9606 GN=GDPD3 PE=1 SV=3
2	Q99LY2	0.0	512	330	0.764	0.736	GDPD3_MOUSE Lysophospholipase D GDPD3 OS=Mus musculus OX=10090 GN=Gdpd3 PE=1 SV=2
3	Q6P2T3	1.50e-99	297	315	0.465	0.470	Q6P2T3_DANRE Glycerophosphodiester phosphodiesterase domain containing 1 like OS=Danio rerio OX=7955 GN=gdpd3 PE=2 SV=1
4	Q8N9F7	3.81e-88	268	314	0.406	0.411	GDPD1_HUMAN Lysophospholipase D GDPD1 OS=Homo sapiens OX=9606 GN=GDPD1 PE=1 SV=2
5	Q9CRY7	1.58e-85	261	314	0.403	0.408	GDPD1_MOUSE Lysophospholipase D GDPD1 OS=Mus musculus OX=10090 GN=Gdpd1 PE=1 SV=1
6	Q08959	1.14e-10	63.9	321	0.217	0.215	PGC1_YEAST Phosphatidylglycerol phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGC1 PE=1 SV=1
7	Q9NZC3	8.83e-05	45.8	331	0.079	0.076	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
8	Q9JL56	8.99e-05	45.8	331	0.079	0.076	GDE1_MOUSE Glycerophosphodiester phosphodiesterase 1 OS=Mus musculus OX=10090 GN=Gde1 PE=1 SV=1
9	Q9JL55	1.00e-04	45.8	331	0.079	0.076	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
10	P10908	1.27e-04	45.1	247	0.072	0.093	UGPQ_ECOLI Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1
11	P09394	2.20e-04	44.7	358	0.075	0.067	GLPQ_ECOLI Glycerophosphodiester phosphodiesterase, periplasmic OS=Escherichia coli (strain K12) OX=83333 GN=glpQ PE=1 SV=2
12	Q9C907	0.026	38.5	392	0.050	0.041	GDPD5_ARATH Glycerophosphodiester phosphodiesterase GDPD5 OS=Arabidopsis thaliana OX=3702 GN=GDPD5 PE=2 SV=1
13	Q57YK9	0.046	37.7	333	0.075	0.072	Q57YK9_TRYB2 GP-PDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.720 PE=4 SV=1
14	Q59S57	0.19	35.8	405	0.050	0.040	Q59S57_CANAL Phosphatidylglycerol phospholipase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C602420WA PE=4 SV=1
15	Q8IM31	0.39	34.7	475	0.094	0.063	Q8IM31_PLAF7 Glycerophosphodiester phosphodiesterase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1406300 PE=4 SV=1
16	A0A1D8PNZ7	0.81	33.9	1162	0.066	0.018	GDE1_CANAL Glycerophosphocholine phosphodiesterase GDE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GDE1 PE=1 SV=1
17	Q8C0L9	0.85	33.9	675	0.053	0.025	GPCP1_MOUSE Glycerophosphocholine phosphodiesterase GPCPD1 OS=Mus musculus OX=10090 GN=Gpcpd1 PE=1 SV=1
18	Q02979	0.89	33.9	1223	0.082	0.021	GDE1_YEAST Glycerophosphocholine phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDE1 PE=1 SV=1
19	Q9C104	0.94	33.9	1076	0.063	0.019	GDE1_SCHPO Glycerophosphocholine phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gde1 PE=1 SV=1
20	Q86BJ0	1.7	33.1	711	0.053	0.024	Q86BJ0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18135 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03009 GDPD	2.6e-23	94.7	Glycerophosphoryl diester phosphodiesterase family
2	PF13653 GDPD_2	2.2e+02	13.7	Glycerophosphoryl diester phosphodiesterase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384363

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317300	0.906	Lysophospholipid acyltransferase LPCAT4
2	9606.ENSP00000321038	0.906	Lysoplasmalogenase
3	9606.ENSP00000296741	0.903	Ectonucleotide pyrophosphatase/phosphodiesterase family member 6
4	9606.ENSP00000284116	0.819	Lysophospholipase D GDPD1
5	9606.ENSP00000311447	0.778	Aspartate beta-hydroxylase domain containing 1
6	9606.ENSP00000393847	0.763	Group 10 secretory phospholipase A2
7	9606.ENSP00000481917	0.742	Seizure 6-like protein 2
8	9606.ENSP00000243501	0.717	Group XIIA secretory phospholipase A2
9	9606.ENSP00000333142	0.717	85/88 kDa calcium-independent phospholipase A2
10	9606.ENSP00000356436	0.710	Cytosolic phospholipase A2
11	9606.ENSP00000472546	0.707	Cytosolic phospholipase A2 gamma
12	9606.ENSP00000320337	0.694	HRAS-like suppressor 3
13	9606.ENSP00000381821	0.686	Protein yippee-like 3
14	9606.ENSP00000457016	0.686	INO80 complex subunit E
15	9606.ENSP00000340017	0.682	Double C2-like domain-containing protein alpha
16	9606.ENSP00000279392	0.681	HIRA-interacting protein 3
17	9606.ENSP00000371886	0.680	JMJD7-PLA2G4B readthrough
18	9606.ENSP00000396045	0.679	Cytosolic phospholipase A2 beta
19	9606.ENSP00000369863	0.668	Protein FAM57B
20	9606.ENSP00000362123	0.667	Group XIIB secretory phospholipase A2-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008081	1.000	phosphoric diester hydrolase activity
GO:0004620	0.991	phospholipase activity
GO:0052689	0.979	carboxylic ester hydrolase activity
GO:0004622	0.881	lysophospholipase activity
GO:0005488	0.779	binding
GO:0005515	0.473	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0034308	0.991	primary alcohol metabolic process
GO:0006576	0.991	biogenic amine metabolic process
GO:0009987	0.839	cellular process
GO:0044237	0.825	cellular metabolic process
GO:0044238	0.799	primary metabolic process
GO:0006629	0.570	lipid metabolic process
GO:0006796	0.562	phosphate-containing compound metabolic process
GO:0019637	0.560	organophosphate metabolic process
GO:0006644	0.506	phospholipid metabolic process
GO:0006650	0.467	glycerophospholipid metabolic process
GO:0046470	0.366	phosphatidylcholine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0005576	0.967	extracellular region
GO:0016020	0.938	membrane
GO:0031982	0.887	vesicle
GO:0031090	0.785	organelle membrane
GO:0005615	0.777	extracellular space
GO:0065010	0.565	extracellular membrane-bounded organelle
GO:1903561	0.557	extracellular vesicle
GO:0070062	0.551	extracellular exosome
GO:0005789	0.337	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	1.000	Phosphoric diester hydrolases.
EC:3.1.1.-	0.979	Carboxylic ester hydrolases.
RHEA:15177	0.881	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	0.881	lysophospholipase.

[back to server]