StarFunc result for job id Q7L5N7

User Input

>input (544 residues)
MSRCAQAAEVAATVPGAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQIGSARRVQIVL
LGIILLPIRVLLVALILLLAWPFAAISTVCCPEKLTHPITGWRRKITQTALKFLGRAMFF
SMGFIVAVKGKIASPLEAPVFVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRLLR
AVQPVLVSRVDPDSRKNTINEIIKRTTSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPG
VPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTKVEVEFMPVQVPNDEEKNDPV
LFANKVRNLMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRKLKLDWDGV
RKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGL
AVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDS
ISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSD
KKDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L5N7	1.000	1.000	1.737E-91	544	1.000	1.000	Q7L5N7.pdb.gz	PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1
2	AFDB:Q8BYI6	0.867	0.867	4.386E-80	544	0.884	0.884	Q8BYI6.pdb.gz	PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus OX=10090 GN=Lpcat2 PE=1 SV=1
3	AFDB:Q1HAQ0	0.598	0.609	4.061E-43	534	0.415	0.423	Q1HAQ0.pdb.gz	PCAT1_RAT Lysophosphatidylcholine acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Lpcat1 PE=1 SV=2
4	AFDB:Q8NF37	0.593	0.603	2.808E-41	534	0.406	0.414	Q8NF37.pdb.gz	PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2
5	AFDB:Q643R3	0.523	0.542	5.954E-40	524	0.369	0.384	Q643R3.pdb.gz	LPCT4_HUMAN Lysophospholipid acyltransferase LPCAT4 OS=Homo sapiens OX=9606 GN=LPCAT4 PE=1 SV=1
6	AFDB:Q0KHU5	0.575	0.586	5.077E-37	533	0.312	0.319	Q0KHU5.pdb.gz	PCAT_DROME Lysophosphatidylcholine acyltransferase OS=Drosophila melanogaster OX=7227 GN=LPCAT PE=2 SV=1
7	AFDB:A0A060X5E8	0.580	0.779	1.576E-36	398	0.309	0.422	A0A060X5E8.pdb.gz	A0A060X5E8_ONCMY Phospholipid/glycerol acyltransferase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020502001 PE=3 SV=1
8	AFDB:Q8S8S2	0.714	0.720	4.329E-34	539	0.248	0.250	Q8S8S2.pdb.gz	LPCT2_ARATH Lysophospholipid acyltransferase LPEAT2 OS=Arabidopsis thaliana OX=3702 GN=LPEAT2 PE=1 SV=1
9	AFDB:Q38BL2	0.524	0.387	1.178E-20	761	0.221	0.158	Q38BL2.pdb.gz	Q38BL2_TRYB2 Phospholipid/glycerol acyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3450 PE=4 SV=1
10	AFDB:Q8L7R3	0.493	0.666	2.024E-20	398	0.165	0.226	Q8L7R3.pdb.gz	LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana OX=3702 GN=LPEAT1 PE=1 SV=1
11	PDB:2zfdA	0.165	0.444	1.848E-5	183	0.077	0.230	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
12	PDB:6tz8B	0.147	0.412	4.065E-5	174	0.064	0.201	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
13	PDB:5aanA	0.148	0.389	5.200E-5	183	0.077	0.230	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
14	PDB:5x9aB	0.143	0.338	5.462E-5	198	0.074	0.202	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
15	PDB:1v1fA	0.153	0.389	7.711E-5	188	0.072	0.207	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
16	PDB:2f2pA	0.141	0.407	1.036E-4	169	0.072	0.231	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
17	PDB:1ggzA	0.129	0.445	1.144E-4	144	0.061	0.229	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
18	PDB:1omrA	0.132	0.310	1.463E-4	201	0.079	0.214	1omrA.pdb.gz	Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
19	PDB:7ukhI	0.139	0.367	1.463E-4	181	0.074	0.221	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
20	PDB:4e53A	0.142	0.409	2.394E-4	168	0.066	0.214	4e53A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L5N7	0.0	1118	544	1.000	1.000	PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1
2	Q8BYI6	0.0	973	544	0.884	0.884	PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus OX=10090 GN=Lpcat2 PE=1 SV=1
3	Q3TFD2	5.69e-160	468	534	0.443	0.451	PCAT1_MOUSE Lysophosphatidylcholine acyltransferase 1 OS=Mus musculus OX=10090 GN=Lpcat1 PE=1 SV=1
4	Q1HAQ0	1.36e-158	464	534	0.430	0.438	PCAT1_RAT Lysophosphatidylcholine acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Lpcat1 PE=1 SV=2
5	Q8NF37	1.89e-154	454	534	0.417	0.425	PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2
6	A0A060X5E8	5.11e-120	361	398	0.314	0.430	A0A060X5E8_ONCMY Phospholipid/glycerol acyltransferase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020502001 PE=3 SV=1
7	Q643R3	4.57e-115	352	524	0.382	0.397	LPCT4_HUMAN Lysophospholipid acyltransferase LPCAT4 OS=Homo sapiens OX=9606 GN=LPCAT4 PE=1 SV=1
8	Q6NVG1	3.42e-112	345	524	0.384	0.399	LPCT4_MOUSE Lysophospholipid acyltransferase LPCAT4 OS=Mus musculus OX=10090 GN=Lpcat4 PE=1 SV=1
9	Q0KHU5	2.03e-99	312	533	0.324	0.330	PCAT_DROME Lysophosphatidylcholine acyltransferase OS=Drosophila melanogaster OX=7227 GN=LPCAT PE=2 SV=1
10	A0A060XS70	6.56e-84	267	373	0.222	0.324	A0A060XS70_ONCMY Lysophosphatidylcholine acyltransferase 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00035526001 PE=4 SV=1
11	Q8S8S2	1.06e-52	189	539	0.252	0.254	LPCT2_ARATH Lysophospholipid acyltransferase LPEAT2 OS=Arabidopsis thaliana OX=3702 GN=LPEAT2 PE=1 SV=1
12	A0A060XK41	2.17e-48	167	180	0.151	0.456	A0A060XK41_ONCMY Phospholipid/glycerol acyltransferase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00035523001 PE=3 SV=1
13	Q8L7R3	1.12e-34	137	398	0.175	0.239	LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana OX=3702 GN=LPEAT1 PE=1 SV=1
14	Q38BL2	9.07e-28	120	761	0.199	0.142	Q38BL2_TRYB2 Phospholipid/glycerol acyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3450 PE=4 SV=1
15	Q9W1B5	6.60e-14	76.3	459	0.108	0.129	Q9W1B5_DROME Glycerol-3-phosphate acyltransferase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=2
16	Q9N5S9	1.35e-13	75.1	410	0.112	0.149	Q9N5S9_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=2
17	Q9N5S8	2.87e-13	74.7	617	0.112	0.099	Q9N5S8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=1
18	Q96LZ3	1.56e-12	68.2	170	0.066	0.212	CANB2_HUMAN Calcineurin subunit B type 2 OS=Homo sapiens OX=9606 GN=PPP3R2 PE=1 SV=3
19	P25296	1.72e-12	68.2	175	0.088	0.274	CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNB1 PE=1 SV=3
20	Q6PC38	3.28e-12	67.8	193	0.077	0.218	Q6PC38_DANRE Recoverin OS=Danio rerio OX=7955 GN=rcv2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	3.7e-07	41.3	Acyltransferase
2	PF05042 Caleosin	3.3e+02	12.6	Caleosin related protein
3	PF00036 EF-hand_1	3.6e-12	56.0	EF hand
4	PF12763 EF-hand_4	1.9	19.9	Cytoskeletal-regulatory complex EF hand
5	PF13202 EF-hand_5	4.6e-07	40.2	EF hand
6	PF13405 EF-hand_6	1.9e-10	50.7	EF-hand domain
7	PF13499 EF-hand_7	2e-09	49.1	EF-hand domain pair
8	PF13833 EF-hand_8	5e-05	34.3	EF-hand domain pair
9	PF04760 IF2_N	1.1e+02	14.0	Translation initiation factor IF-2, N-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274793	0.958	Platelet-activating factor acetylhydrolase
2	9606.ENSP00000261407	0.955	Lysophospholipid acyltransferase 5
3	9606.ENSP00000441980	0.953	Choline/ethanolaminephosphotransferase 1
4	9606.ENSP00000229266	0.948	Cholinephosphotransferase 1
5	9606.ENSP00000368140	0.938	Cardiolipin synthase (CMP-forming)
6	9606.ENSP00000255389	0.927	Phosphatidylethanolamine N-methyltransferase
7	9606.ENSP00000320337	0.920	HRAS-like suppressor 3
8	9606.ENSP00000363400	0.920	Platelet-activating factor acetylhydrolase 2, cytoplasmic
9	9606.ENSP00000430548	0.909	Phosphatidylserine synthase 1
10	9606.ENSP00000283415	0.908	Lysophosphatidylcholine acyltransferase 1
11	9606.ENSP00000317300	0.908	Lysophospholipid acyltransferase LPCAT4
12	9606.ENSP00000310551	0.875	Lysocardiolipin acyltransferase 1
13	9606.ENSP00000355964	0.852	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1
14	9606.ENSP00000312286	0.817	Phospholipase A2
15	9606.ENSP00000444935	0.809	Platelet-activating factor acetylhydrolase IB subunit gamma
16	9606.ENSP00000435289	0.806	Platelet-activating factor acetylhydrolase IB subunit beta
17	9606.ENSP00000380378	0.804	Platelet-activating factor acetylhydrolase IB subunit alpha
18	9606.ENSP00000356436	0.801	Cytosolic phospholipase A2
19	9606.ENSP00000320043	0.790	Acyl-protein thioesterase 1
20	9606.ENSP00000298299	0.784	Zinc finger protein 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008374	1.000	O-acyltransferase activity
GO:0005515	0.997	protein binding
GO:0042171	0.997	lysophosphatidic acid acyltransferase activity
GO:0016411	0.988	acylglycerol O-acyltransferase activity
GO:0003841	0.983	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0016407	0.954	acetyltransferase activity
GO:0047184	0.815	1-acylglycerophosphocholine O-acyltransferase activity
GO:0016413	0.542	O-acetyltransferase activity
GO:0047144	0.455	2-acylglycerol-3-phosphate O-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0006629	0.995	lipid metabolic process
GO:0006650	0.992	glycerophospholipid metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:1901564	0.939	organonitrogen compound metabolic process
GO:0046470	0.918	phosphatidylcholine metabolic process
GO:0008654	0.474	phospholipid biosynthetic process
GO:0045017	0.439	glycerolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	1.000	endoplasmic reticulum
GO:0031984	0.999	organelle subcompartment
GO:0043228	0.972	non-membrane-bounded organelle
GO:0043232	0.951	intracellular non-membrane-bounded organelle
GO:0031090	0.904	organelle membrane
GO:0005789	0.849	endoplasmic reticulum membrane
GO:0005811	0.701	lipid droplet

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:19709	0.983	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.983	1-acylglycerol-3-phosphate O-acyltransferase.
RHEA:12937	0.815	a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA
EC:2.3.1.23	0.815	1-acylglycerophosphocholine O-acyltransferase.
RHEA:14233	0.455	a 2-acyl-sn-glycerol 3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.52	0.455	2-acylglycerol-3-phosphate O-acyltransferase.

[back to server]