StarFunc result for job id Q7L5Y1

User Input

>input (443 residues)
MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGK
GTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLN
AVWDLWAKQEGKPVWKLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREK
QMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDMRRCQIIRDM
IGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVPLGIG
IATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVG
LCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKE
ESVKKHQYPDGEVWKKLLPAQEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7L5Y1	1.000	1.000	7.792E-89	443	1.000	1.000	Q7L5Y1.pdb.gz	ENOF1_HUMAN Mitochondrial enolase superfamily member 1 OS=Homo sapiens OX=9606 GN=ENOSF1 PE=1 SV=1
2	PDB:4a35A	0.985	0.989	3.002E-79	441	0.989	0.993	4a35A.pdb.gz	Enzymatic and structural characterization of rTS gamma provides insights into the function of rTS beta.
3	AFDB:Q8P3K2	0.972	0.976	2.683E-59	441	0.508	0.510	Q8P3K2.pdb.gz	FUCD_XANCP L-fuconate dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4069 PE=1 SV=1
4	AFDB:A2R805	0.947	0.929	3.454E-57	452	0.530	0.520	A2R805.pdb.gz	A2R805_ASPNC L-fuconate dehydratase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An16g05390 PE=4 SV=1
5	AFDB:Q0QWS4	0.968	0.953	5.019E-57	450	0.515	0.507	Q0QWS4.pdb.gz	LGD1_HYPJE L-galactonate dehydratase OS=Hypocrea jecorina OX=51453 GN=lgd1 PE=1 SV=1
6	PDB:1yeyC	0.958	0.975	3.515E-56	435	0.506	0.515	1yeyC.pdb.gz	Crystal Structure of L-fuconate Dehydratase from Xanthomonas campestris pv. campestris str. ATCC 33913
7	PDB:2pp1A	0.718	0.800	1.477E-24	395	0.221	0.248	2pp1A.pdb.gz	Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
8	AFDB:Q8ZL58	0.719	0.795	3.387E-24	398	0.221	0.246	Q8ZL58.pdb.gz	TAGAD_SALTY L-talarate/galactarate dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=STM3697 PE=1 SV=1
9	AFDB:Q97U96	0.746	0.879	6.779E-24	373	0.185	0.220	Q97U96.pdb.gz	ARAD_SACS2 Arabinonate dehydratase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=araD PE=1 SV=1
10	PDB:4jn7A	0.658	0.731	5.754E-20	395	0.199	0.223	4jn7A.pdb.gz
11	AFDB:B3Q5L5	0.662	0.736	1.391E-19	395	0.201	0.225	B3Q5L5.pdb.gz	B3Q5L5_RHIE6 Putative racemase protein OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=RHECIAT_PC0000418 PE=4 SV=1
12	AFDB:A9CG74	0.657	0.731	2.250E-19	395	0.190	0.213	A9CG74.pdb.gz	A9CG74_AGRFC Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu4196 PE=4 SV=1
13	AFDB:Q704D2	0.689	0.619	2.356E-18	497	0.178	0.159	Q704D2.pdb.gz	GAD_THETE D-gluconate dehydratase OS=Thermoproteus tenax OX=2271 GN=gad PE=1 SV=1
14	AFDB:Q97U27	0.683	0.760	2.603E-17	395	0.158	0.177	Q97U27.pdb.gz	GAD_SACS2 D-gluconate/D-galactonate dehydratase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=gad PE=1 SV=1
15	PDB:4e4fB	0.680	0.783	4.550E-17	381	0.172	0.199	4e4fB.pdb.gz	Crystal structure of ENOLASE PC1_0802 from Pectobacterium carotovorum
16	PDB:3q45A	0.644	0.764	6.974E-17	368	0.174	0.209	3q45A.pdb.gz	Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
17	PDB:3dfhA	0.675	0.821	1.553E-16	359	0.163	0.201	3dfhA.pdb.gz
18	PDB:3tjiA	0.676	0.745	1.823E-16	399	0.160	0.178	3tjiA.pdb.gz	Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with boung mg
19	PDB:3gy1B	0.689	0.780	2.381E-16	388	0.165	0.188	3gy1B.pdb.gz	CRYSTAL STRUCTURE OF putative mandelate racemase/muconate lactonizing protein from Clostridium beijerinckii NCIMB 8052
20	PDB:3jvaB	0.632	0.776	2.381E-16	354	0.147	0.184	3jvaB.pdb.gz	Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7L5Y1	0.0	920	443	1.000	1.000	ENOF1_HUMAN Mitochondrial enolase superfamily member 1 OS=Homo sapiens OX=9606 GN=ENOSF1 PE=1 SV=1
2	Q8P3K2	6.73e-169	483	441	0.508	0.510	FUCD_XANCP L-fuconate dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4069 PE=1 SV=1
3	A2R805	5.46e-167	479	452	0.530	0.520	A2R805_ASPNC L-fuconate dehydratase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An16g05390 PE=4 SV=1
4	Q0QWS4	1.74e-163	470	450	0.512	0.504	LGD1_HYPJE L-galactonate dehydratase OS=Hypocrea jecorina OX=51453 GN=lgd1 PE=1 SV=1
5	Q8ZL58	6.39e-25	107	398	0.201	0.224	TAGAD_SALTY L-talarate/galactarate dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=STM3697 PE=1 SV=1
6	Q97U96	1.53e-17	86.3	373	0.208	0.247	ARAD_SACS2 Arabinonate dehydratase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=araD PE=1 SV=1
7	A9CG74	4.53e-13	72.8	395	0.208	0.233	A9CG74_AGRFC Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu4196 PE=4 SV=1
8	Q6BF17	9.81e-12	68.6	382	0.205	0.238	DGOD_ECOLI D-galactonate dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=dgoD PE=1 SV=1
9	B3Q5L5	1.15e-11	68.6	395	0.192	0.215	B3Q5L5_RHIE6 Putative racemase protein OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=RHECIAT_PC0000418 PE=4 SV=1
10	Q704D2	1.90e-11	68.2	497	0.178	0.159	GAD_THETE D-gluconate dehydratase OS=Thermoproteus tenax OX=2271 GN=gad PE=1 SV=1
11	A2R1E3	4.29e-11	66.6	422	0.088	0.092	A2R1E3_ASPNC Contig An13c0040, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An13g00920 PE=4 SV=1
12	Q11T61	4.60e-11	66.2	368	0.095	0.114	AAEP_CYTH3 D-Ala-D/L-Ala epimerase OS=Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465) OX=269798 GN=tfdD PE=1 SV=1
13	B9JNP7	2.35e-10	64.3	395	0.138	0.154	B9JNP7_AGRRK Isomerase protein OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=Arad_7740 PE=1 SV=1
14	B9I2J6	2.00e-09	61.6	421	0.093	0.097	AXEP_POPTR L-Ala-D/L-amino acid epimerase OS=Populus trichocarpa OX=3694 GN=POPTR_0012s05040g PE=3 SV=2
15	Q834W6	3.49e-09	60.5	354	0.088	0.110	HYEP_ENTFA Hydrophobic dipeptide epimerase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_1511 PE=1 SV=1
16	A4WA78	1.01e-08	59.3	404	0.203	0.223	MAND_ENT38 D-galactonate dehydratase family member Ent638_1932 OS=Enterobacter sp. (strain 638) OX=399742 GN=Ent638_1932 PE=1 SV=1
17	Q81IL5	1.83e-08	58.5	369	0.106	0.127	NSAR_BACCR N-succinyl-L-Arg/Lys racemase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=BC_0371 PE=1 SV=1
18	B5RAG0	3.97e-08	57.4	404	0.205	0.225	MAND_SALG2 D-galactonate dehydratase family member RspA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=rspA PE=1 SV=1
19	B1ELW6	2.08e-07	55.1	404	0.187	0.205	MAND_ESCAT D-galactonate dehydratase family member RspA OS=Escherichia albertii (strain TW07627) OX=502347 GN=rspA PE=1 SV=1
20	Q8FHC7	2.50e-07	55.1	415	0.185	0.198	MAND_ECOL6 D-galactonate dehydratase family member RspA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=rspA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10004 DUF2247	3.1e+02	12.5	Uncharacterized protein conserved in bacteria (DUF2247)
2	PF13378 MR_MLE_C	9.5e-53	190.6	Enolase C-terminal domain-like
3	PF02746 MR_MLE_N	1.4e-07	43.1	Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008966835.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008976639.1	0.924	Belongs to the DapA family.
2	9597.XP_008960184.1	0.798	Sorbitol dehydrogenase
3	9597.XP_003809721.1	0.793	Regucalcin
4	9597.XP_008948999.1	0.791	Belongs to the DapA family.
5	9597.XP_003815296.1	0.759	Monoglyceride lipase
6	9597.XP_003808511.1	0.747	Amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
7	9597.XP_003817682.1	0.726	Converts alpha-aldose to the beta-anomer.
8	9597.XP_003813051.1	0.710	Adenosine kinase
9	9597.XP_003827178.1	0.710	Catalyzes the phosphorylation of ribose at O-5 in a reaction requiring ATP and magnesium. The resulting D-ribose-5-phosphate can then be used either for sythesis of nucleotides, histidine, and tryptophan, or as a component of the pentose phosphate pathway.
10	9597.XP_003822008.1	0.706	Carboxymethylenebutenolidase homolog
11	9597.XP_008953590.1	0.702	3-hydroxybutyrate dehydrogenase type 2 isoform X1
12	9597.XP_003816334.2	0.692	uroporphyrinogen-III synthase isoform X1
13	9597.XP_008973626.1	0.684	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial
14	9597.XP_003830444.1	0.677	Cleavage stimulation factor subunit 3
15	9597.XP_003818814.1	0.667	Glycerate kinase isoform X1
16	9597.XP_003806345.1	0.660	Hydroxyacid oxidase 2 isoform X1
17	9597.XP_003821407.1	0.660	Hydroxyacid oxidase 1
18	9597.XP_003815680.1	0.653	Thymidylate synthetase
19	9597.XP_003820999.1	0.652	Membrane associated ring-CH-type finger 7
20	9597.XP_003822172.1	0.647	Enolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016836	1.000	hydro-lyase activity
GO:0000287	1.000	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0016052	0.994	carbohydrate catabolic process
GO:0044248	0.992	cellular catabolic process
GO:0044275	0.774	cellular carbohydrate catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.963	cytosol
GO:0043226	0.815	organelle
GO:0043227	0.732	membrane-bounded organelle
GO:0043231	0.576	intracellular membrane-bounded organelle
GO:0005576	0.510	extracellular region
GO:0016020	0.441	membrane
GO:0005886	0.378	plasma membrane
GO:0005634	0.327	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.2.1.-	1.000	Hydro-lyases.

[back to server]